KEGG   Anopheles gambiae (mosquito): AgaP_AGAP001919Help
Entry
AgaP_AGAP001919   CDS       T01036                                 

Definition
AGAP001919-PA
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:aga00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    AgaP_AGAP001919
Enzymes [BR:aga01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     AgaP_AGAP001919
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2R
AA seq 445 aa AA seqDB search
MIPRAAERLLVLVGLLLFVTGSSQALYSSSDDVVALTTANFDRTVVKSDEVWVVEFYAPF
CGHCRNLVPEYKKAATALKGVIKVGGVNCEEEQGLCGQHGVRGYPTIKIFGANKRSPVDY
NGQRTAKDIAEAALAEAKKKIKNVLGGGGGSSSSGGSGSNSGSGSKDDVIELTDANFDKL
VLQSEEPWLVEFYAPWCGHCKNLAPHWARAATELKGKVKLGALDATVHQQKMSEYGVQGF
PTIKYFPAGTKDRNSAEDYNGGRTSSDIVNWAQDKYTEDIPSPEIVQLTSEQVARDTCEK
KPLCVVSVLPHILDCNADCRNGYLKILQEMGDKYKKKEWGWLWTEGGAQLDLESTLDIGG
FGYPAMAVVNLKKMKYSLLRGSFSKDGINEFLRDLSFGRGHTAPVKGAELPKIHTVEPWD
GKDGQLPVEEDIDLSDVDLDEKDEL
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgattccgcgggcagctgaaaggttgctggtgctagtggggttgctactcttcgtcacc
ggctcctcgcaagcgctgtactcatcgtccgatgatgtcgtggcactgacgacggccaac
ttcgaccgcaccgtggtgaaaagcgacgaggtgtgggtggtcgagttttacgcacccttc
tgtggccactgccgcaatctggtgccggagtacaagaaggccgccaccgcactgaagggc
gtcatcaaggtaggcggtgtgaactgcgaggaagagcagggtctctgcgggcagcacggt
gtgcgtggctatccgaccatcaagatcttcggtgcgaacaaacgctccccggtcgattac
aacggacagcgcacggccaaggacattgcggaggcggccctggcggaagcgaagaaaaag
atcaagaatgttctgggcggtggtggtggcagcagcagcagcggtggcagtggtagcaac
agcggcagcggatccaaggacgacgtcatcgagctgaccgatgccaacttcgataagctg
gtgctgcagagcgaggaaccgtggctggtggagttctacgcaccgtggtgtggacactgc
aaaaatctggccccgcactgggcccgggcagcgaccgagctgaagggcaaggtgaagctg
ggcgcactcgatgcgaccgtgcaccagcagaagatgtccgagtacggtgtgcagggcttc
ccgacgatcaagtacttcccggcgggcaccaaggatcgcaactcggccgaagactacaac
ggtggccgcacatcgtccgacatcgtgaactgggcgcaggacaagtacacggaagacatc
cccagcccggaaatcgtgcagctcacctcggagcaggtggcccgggacacgtgcgaaaag
aagccgctgtgcgtggtgtccgtgctgccgcacattctcgactgcaatgccgactgccgc
aacggctatctgaagattctgcaggagatgggtgacaagtacaagaagaaggaatggggc
tggctgtggacggagggtggcgcacagctcgacctggaatcgacgctggacatcggtgga
tttggctatcccgccatggcggtggtgaacctgaagaagatgaagtactcgctgctgcgc
ggctcgttctcgaaggatggcatcaacgagtttttgcgcgacctttcgttcggccggggc
cacaccgcaccggtgaagggtgccgagctgccaaagattcacacggtcgagccgtgggac
ggcaaggacggacagctgccggtggaggaggatatcgacctttcggatgtcgatctggac
gagaaggatgagctgtaa

DBGET integrated database retrieval system