KEGG   Anopheles gambiae (mosquito): AgaP_AGAP001936Help
Entry
AgaP_AGAP001936   CDS       T01036                                 

Definition
AGAP001936-PA
Orthology
K05858  
phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Wnt signaling pathway
Phototransduction - fly
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:aga00562]
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:aga04310]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:aga04070]
Organismal Systems; Sensory system; Phototransduction - fly [PATH:aga04745]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
Position
2R
AA seq 1089 aa AA seqDB search
MTKKFEFNWQIPVPEPLLTGCVFDRWTEEKDNNELEPNCMFKVDEYGFFIYWKSEGREGD
VIELCQVSDIRAGGMPKDMKLYNQLCNKHGENVEEKSLTICSGTDYININYQHVVCPDAA
TAKLWQQGLRDITHNIKMNNVCVWTNLMKHWMRLGFLVDPRGKVPVKVVARTFASGKTEK
LVYQILSDLGLPSGKNDVIEKADFTFEKFYELYHKICPRNDIEELFRSITQGKANAINLD
QFINFLNEKQRDPRLNEILYPLYDEKRALEIITTYEQNDEAREAKTLTKDGLIRYLMSDE
NAPVFLDRLDIYMDMDQPLSHYYINSSHNTYLSGRQFGGKSSVEMYRQTLLAGCRCVELD
CWDGKGEDEEPIITHGMAMCTDILFKDVIYALRDTAFVTSDYPVILSFENHCCKSQQYKL
AKYCDEILGDLLLKEPIPDYPLEPGAVLPPPSLLKRKILIKNKRLKPEVEKKELELFLQG
EFVIEDEVKEDASAVDVTKIAELEAPAAAAAVVPVAAAAASQDGGEEAPPVQYTGSTTNV
HPWLSSMVNYAQPVKFQSFDYADKKNVHHNMSSFAETTGMNLLKSQAIEFVNYNKRQMSR
IYPKGTRADSSNYMPQVFWNAGCQMVSLNFQTSDLPMQLNQGKFEYNGNCGYLLKPDFMR
RADRSFDPFADAPVDGVIAASCAVQVIAGQFLSDKKVGTYVEVDMYGLPSDTVRKEFRTR
MVPANGLNPVYNEEPFLFRKVVLPDLAVLRFGVYDENGKLLGQRILPLDGLQGGYRHISL
RTEANFPMSLPMLFCNIELKIYVPDGFEDFMDALSDPRAFMGAAKERSDNMKAMGIEETG
KKDKEEAARKEEQRVTEPPLVFDPITVDSLRQEKGFQKTAKKQQKELDAVKKKHAKERAG
VQKQQNAAIERLVKGKSKEEIKADPAVRKLIQEQNAQWTEMAERHKKEEWELLKQQLADQ
QDILRKLMETTQAAQMKQLEAKHEREIKELNSRQAKISVETSKEVANDKTLKTKGEKDRR
LREKKQNNIKRFMDEKKTATIKQNREKEKLKVTHDKQLEELANDVQKLIEMYKVDEEEYK
LASKYEFFA
NT seq 3270 nt NT seq  +upstreamnt  +downstreamnt
atgacgaagaagttcgagttcaactggcagatcccggtgccggaaccgctccttaccgga
tgcgtgttcgaccggtggacggaggagaaggacaacaacgagctggaaccgaactgcatg
ttcaaggtggacgagtacgggtttttcatctactggaaaagcgaaggacgggaaggtgac
gttattgaattatgtcaagtcagcgatatccgagcgggcggaatgccaaaggacatgaag
ctgtacaatcaactgtgcaacaagcacggcgaaaatgtggaggaaaaatctctcaccatc
tgctcgggcacggactacatcaacatcaactatcagcatgtcgtctgtccggacgctgca
acggcgaagctctggcagcaaggtcttcgcgacattacacacaacatcaaaatgaacaac
gtttgcgtatggaccaacttgatgaagcattggatgaggttgggctttctagtggatccg
cgcggaaaagtgcctgtcaaggtggttgcccgaacgttcgcctccggcaagacggaaaag
ctggtatatcagatactctccgatctggggctgccgagcggcaagaacgatgtgatcgag
aaagcggactttacgttcgaaaagttctacgagctgtaccacaagatctgtccccgcaat
gacatcgaagagctgttccggtcgatcacgcaaggtaaagcgaacgccatcaatctggat
cagtttatcaactttctcaacgagaagcagcgcgatccccggctaaacgagatcctctac
ccgctgtacgatgagaagcgtgcgctggaaatcatcaccacgtacgagcagaacgatgaa
gcgcgggaagcgaaaaccctcaccaaagacggcctgatccggtacctcatgtcggacgag
aatgcgcccgtgtttctcgaccggctcgacatctacatggacatggatcagccgctgtcc
cactactacatcaactcgtcccacaacacgtacctgtccgggcggcagttcgggggcaag
agctcggtcgagatgtaccgccagacgctgctggccggctgtcggtgcgtcgagctggac
tgctgggacggcaagggcgaggacgaggagccgatcatcacgcacggcatggcgatgtgc
acggacatactgttcaaggatgtgatttacgcgctgcgcgacaccgccttcgtcacctcc
gactatccggtgatactgtcgttcgagaaccactgctgcaaatcgcaacagtacaagctg
gcgaagtactgtgacgaaattttgggcgacctgctgctgaaggaaccgatcccggactat
ccgctcgagccgggggccgtgctgccgcccccgtccctgctgaagcgcaagatactgatc
aagaacaagcggctcaagccggaggtggagaagaaggagctggagctgttcctgcagggc
gagttcgtgatcgaggacgaggtgaaggaggacgcgagcgcggtcgacgtgacgaagata
gcggagctggaggcgccggcggcggcggcggcagtggtgccggtggcggcggccgccgcc
tcgcaggacggtggcgaggaggcgcccccggtacagtacaccggctcgacgacgaacgtg
cacccgtggctgtcgtcgatggtgaactacgcgcagccggtcaagttccagtcgttcgac
tacgcggacaagaagaacgtgcaccacaacatgtcgtcgttcgcggagacgaccggcatg
aacctgctcaagtcgcaggcgatcgagttcgtcaactacaacaagcggcagatgtcgcgc
atctacccgaagggtacgcgggccgactcgtccaactacatgccgcaggtgttctggaac
gcgggctgccagatggtgtcgctcaacttccaaacgtccgatctgccgatgcagctgaac
cagggcaagttcgagtacaacggcaactgtggctacctgctgaagccggactttatgcgc
cgggcggaccgcagcttcgacccgttcgcggacgcaccggtggacggtgtgattgcggcg
tcctgcgcggtgcaggtcattgccggccagttcctttccgacaagaaggtgggcacgtac
gtggaggtggacatgtacggcttgccgtcggacacggtgcgcaaggagttccggacgcgc
atggtaccggcgaacgggctcaatccggtgtacaacgaggaaccgttcctgttccgcaag
gtggtgctgcccgatctggccgtgctgcggttcggcgtgtacgacgagaacggcaagctg
ctcgggcagcgcatcctgccgctggacgggctgcagggcggctaccggcacatctcgctc
cgcacggaggccaacttcccgatgtcgctcccgatgctgttctgtaacatcgagctgaag
atctacgtgccggacgggttcgaggactttatggacgcgctgtcggatccgcgcgcgttc
atgggcgcggccaaggagcgctccgacaacatgaaagcgatgggcatcgaggagacgggc
aagaaggacaaggaggaggcggcgcggaaggaggagcagcgcgtcaccgagccgccgctc
gtgttcgacccgatcacggtggactcgctgcggcaggagaagggcttccagaagacggcc
aaaaagcagcagaaggagctggacgcggtgaagaagaagcacgcgaaggagcgggccggc
gtgcagaagcagcagaacgcggcgatcgagcggctggtgaagggcaagagcaaggaggaa
atcaaggcggacccggcggtgcgcaagctgatccaggagcagaacgcccagtggacggag
atggccgagcggcacaagaaggaggagtgggagctgctgaagcagcagctggccgaccag
caggacatactgcgcaagctgatggagacgacgcaggccgcccagatgaagcagctcgag
gcgaagcacgagcgcgagatcaaggagctgaacagccgccaggcgaaaatctcggtcgaa
acgtcgaaggaggtcgccaacgacaaaacgctcaagacgaagggcgaaaaggaccggcgg
ctgcgcgagaagaagcagaacaacattaagcgcttcatggacgagaaaaagactgccacc
atcaagcagaaccgggaaaaggaaaagctgaaagtgacccacgacaagcagctggaggag
ctggcgaacgatgtgcaaaagctcatcgaaatgtacaaagtggacgaggaggaatacaag
ctggcatcgaagtacgaatttttcgcctaa

DBGET integrated database retrieval system