KEGG   Anopheles gambiae (mosquito): AgaP_AGAP002058Help
Entry
AgaP_AGAP002058   CDS       T01036                                 

Definition
AGAP002058-PA
Orthology
K12309  
beta-galactosidase [EC:3.2.1.23]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Galactose metabolism
Other glycan degradation
Glycosaminoglycan degradation
Sphingolipid metabolism
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:aga00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    AgaP_AGAP002058
  Lipid metabolism
   00600 Sphingolipid metabolism
    AgaP_AGAP002058
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    AgaP_AGAP002058
   00604 Glycosphingolipid biosynthesis - ganglio series
    AgaP_AGAP002058
   00511 Other glycan degradation
    AgaP_AGAP002058
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    AgaP_AGAP002058
Enzymes [BR:aga01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     AgaP_AGAP002058
Exosome [BR:aga04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AgaP_AGAP002058
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2R
AA seq 630 aa AA seqDB search
MIAYRVLPLLALCLSGWAATIEAAAQQPPRKFDIDFQNDTFTKDGQPFQFISGSFHYFRA
LPESWRHILRSMRAAGLNTVMTYIEWSLHEPMPGQYQWEGIANLEEFIEIAQSENLFVIL
RPGPYICAERDMGGFPHWLLTKYPSIKLRTYDTDYLREVQNWYNQLMPRLVRYLYGNGGP
VIMVSIENEYGSFKACDGQYMQFLKNLTVHFVQDKAVLFTNDGPELLKCGSIPGILPTLD
FGITNNPNAFWQQLRKYLPKGPLVNAEYYPGWLTHWMEPTARVDAGMVVNTLKLMLNQKA
NVNFYMFFGGTNFGFTAGANDVGPGKYSADITSYDYDAPLDEAGDPTPKYFAIRKVLVEY
FGDPGVPAPVKLPKMTLETVWLERRGSMLSKHGRTMLAQKIVTSVTPVSFEALNQHSGFV
LYETQLPAGYNRDPYTLKVENLHDRAYVHIDGTFAGILSRETNTNTIPLSVGLGTRLQLL
VESQGRINYNIPNDFKGILGTVTVDAKPLYNWTITSFPLDSYRYLENFLTQQPTEQEDLD
GAGAQVYYGTFTISSDTIYDTYLYPSVWGKGLVFINGFNLGRYWPLAGPQITLYVPRHIL
KKGNNQIVMIEYQQHIQHPYVQFIDKPIFM
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgattgcttatcgagtgctaccgctgctagcgctgtgccttagtggctgggctgccacg
attgaagcggccgcccaacaaccaccccgaaagtttgatatcgacttccaaaacgatacc
ttcaccaaagatgggcaaccgttccagtttatctccggctcgtttcactacttccgcgcg
ctgccagaatcgtggcgccacattctgcgctcgatgcgggcggccggactgaatacggtc
atgacctacatcgaatggtcactgcacgagccgatgccgggccagtaccagtgggagggt
atcgccaatttggaggagttcatagagatagcacagagcgagaatctgttcgtgatccta
cgccccggtccgtacatctgtgccgagcgggatatgggcggtttcccccactggctgctg
acaaagtatccttccatcaagctgcgcacgtacgatacagactacttaagagaggtgcaa
aattggtacaatcagctgatgccccgtctcgtccgctatctgtacggcaatggtggtcca
gtgattatggtttcgattgagaatgagtatggttcattcaaggcctgcgatgggcagtac
atgcagttcctcaagaatttaaccgtccatttcgtgcaggataaagcggtgctgtttacg
aacgatgggccggagcttctaaagtgcggttctatccctggcattctacccacgctggac
tttggcattactaacaatccgaacgcgttctggcagcagctgcgcaagtatttgccgaag
ggaccgctggtcaacgcggagtactatcccggctggctaacgcactggatggaaccgacg
gcccgtgtcgatgcgggcatggtcgtcaacacgctcaagctgatgctcaaccagaaagcg
aacgtaaacttttacatgttcttcggtggcaccaacttcggtttcactgccggtgcgaac
gatgtcgggccgggtaagtatagtgcggacataacgtcctacgattacgacgcaccgttg
gatgaggcgggcgatccgacgccaaagtattttgccatccggaaggtgctcgttgagtat
ttcggtgatccaggcgtaccggcaccggtaaagctgcccaaaatgacgctcgaaacggtg
tggctggaacggcgtggatcgatgctgtcgaagcacggtcgaacgatgctcgcacagaag
atagttacttccgtaacgccggtgtccttcgaagcgctcaatcagcattccgggtttgtg
ctgtacgaaactcagctgcccgcggggtacaatcgtgatccttacacgctcaaggtggaa
aatcttcacgatcgggcttatgtgcatatcgacgggacttttgccggaatattgtcccgc
gaaactaacacgaacacgattccgctcagcgttgggctcgggacgcgactgcagctgctg
gtggagagccagggacgcattaactacaacatcccgaacgacttcaagggcatcctcggg
acagtgacagtggatgcgaaaccactgtacaactggaccatcacctcgttcccgctggac
agctatcgctatctggagaacttcttaacccaacagcccaccgagcaggaagatctggat
ggggcgggagcacaggtgtactacggcacgttcacgatcagcagcgacaccatctacgac
acctacctgtacccgagcgtgtggggcaaggggttggtgtttatcaatggcttcaacctg
ggccgctactggccattagctggaccgcagattacgctctacgtgccgagacacattctt
aagaagggaaacaaccagatcgtcatgatcgagtaccagcagcacatccagcatccgtac
gtgcagtttatcgataagcctatctttatgtaa

DBGET integrated database retrieval system