KEGG   Anopheles gambiae (mosquito): AgaP_AGAP002058Help
Entry
AgaP_AGAP002058   CDS       T01036                                 

Definition
AGAP002058-PA
Orthology
K12309  
beta-galactosidase [EC:3.2.1.23]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Galactose metabolism
Other glycan degradation
Glycosaminoglycan degradation
Sphingolipid metabolism
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:aga00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:aga00600]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:aga00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series [PATH:aga00604]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:aga00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:aga04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2R
AA seq 630 aa AA seqDB search
MIAYRVLPLLALCLSGWAATIEAAAQQPPRKFDIDFQNDTFTKDGQPFQFISGSFHYFRA
LPESWRHILRSMRAAGLNTVMTYIEWSLHEPMPGQYQWEGIANLEEFIEIAQSENLFVIL
RPGPYICAERDMGGFPHWLLTKYPSIKLRTYDTDYLREVQNWYNQLMPRLVRYLYGNGGP
VIMVSIENEYGSFKACDGQYMQFLKNLTVHFVQDKAVLFTNDGPELLKCGSIPGILPTLD
FGITNNPNAFWQQLRKYLPKGPLVNAEYYPGWLTHWMEPTARVDAGMVVNTLKLMLNQKA
NVNFYMFFGGTNFGFTAGANDVGPGKYSADITSYDYDAPLDEAGDPTPKYFAIRKVLVEY
FGDPGVPAPVKLPKMTLETVWLERRGSMLSKHGRTMLAQKIVTSVTPVSFEALNQHSGFV
LYETQLPAGYNRDPYTLKVENLHDRAYVHIDGTFAGILSRETNTNTIPLSVGLGTRLQLL
VESQGRINYNIPNDFKGILGTVTVDAKPLYNWTITSFPLDSYRYLENFLTQQPTEQEDLD
GAGAQVYYGTFTISSDTIYDTYLYPSVWGKGLVFINGFNLGRYWPLAGPQITLYVPRHIL
KKGNNQIVMIEYQQHIQHPYVQFIDKPIFM
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgattgcttatcgagtgctaccgctgctagcgctgtgccttagtggctgggctgccacg
attgaagcggccgcccaacaaccaccccgaaagtttgatatcgacttccaaaacgatacc
ttcaccaaagatgggcaaccgttccagtttatctccggctcgtttcactacttccgcgcg
ctgccagaatcgtggcgccacattctgcgctcgatgcgggcggccggactgaatacggtc
atgacctacatcgaatggtcactgcacgagccgatgccgggccagtaccagtgggagggt
atcgccaatttggaggagttcatagagatagcacagagcgagaatctgttcgtgatccta
cgccccggtccgtacatctgtgccgagcgggatatgggcggtttcccccactggctgctg
acaaagtatccttccatcaagctgcgcacgtacgatacagactacttaagagaggtgcaa
aattggtacaatcagctgatgccccgtctcgtccgctatctgtacggcaatggtggtcca
gtgattatggtttcgattgagaatgagtatggttcattcaaggcctgcgatgggcagtac
atgcagttcctcaagaatttaaccgtccatttcgtgcaggataaagcggtgctgtttacg
aacgatgggccggagcttctaaagtgcggttctatccctggcattctacccacgctggac
tttggcattactaacaatccgaacgcgttctggcagcagctgcgcaagtatttgccgaag
ggaccgctggtcaacgcggagtactatcccggctggctaacgcactggatggaaccgacg
gcccgtgtcgatgcgggcatggtcgtcaacacgctcaagctgatgctcaaccagaaagcg
aacgtaaacttttacatgttcttcggtggcaccaacttcggtttcactgccggtgcgaac
gatgtcgggccgggtaagtatagtgcggacataacgtcctacgattacgacgcaccgttg
gatgaggcgggcgatccgacgccaaagtattttgccatccggaaggtgctcgttgagtat
ttcggtgatccaggcgtaccggcaccggtaaagctgcccaaaatgacgctcgaaacggtg
tggctggaacggcgtggatcgatgctgtcgaagcacggtcgaacgatgctcgcacagaag
atagttacttccgtaacgccggtgtccttcgaagcgctcaatcagcattccgggtttgtg
ctgtacgaaactcagctgcccgcggggtacaatcgtgatccttacacgctcaaggtggaa
aatcttcacgatcgggcttatgtgcatatcgacgggacttttgccggaatattgtcccgc
gaaactaacacgaacacgattccgctcagcgttgggctcgggacgcgactgcagctgctg
gtggagagccagggacgcattaactacaacatcccgaacgacttcaagggcatcctcggg
acagtgacagtggatgcgaaaccactgtacaactggaccatcacctcgttcccgctggac
agctatcgctatctggagaacttcttaacccaacagcccaccgagcaggaagatctggat
ggggcgggagcacaggtgtactacggcacgttcacgatcagcagcgacaccatctacgac
acctacctgtacccgagcgtgtggggcaaggggttggtgtttatcaatggcttcaacctg
ggccgctactggccattagctggaccgcagattacgctctacgtgccgagacacattctt
aagaagggaaacaaccagatcgtcatgatcgagtaccagcagcacatccagcatccgtac
gtgcagtttatcgataagcctatctttatgtaa

DBGET integrated database retrieval system