KEGG   Anopheles gambiae (mosquito): AgaP_AGAP002075Help
Entry
AgaP_AGAP002075   CDS       T01036                                 

Definition
AGAP002075-PA
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
aga  Anopheles gambiae (mosquito)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
Position
2R
AA seq 607 aa AA seqDB search
MQRKGCSNTPFQPKRVSELPPLESDSDSDGDGNLNCAILNDSFLLTPSKCIEEDDSVDKK
IPAKATLRTVTDAVPKSRIKLEDKLPAAYAAPEGDPKTVKRAPLVERTQLDPKLINDSSP
TKSTRSHDSGYGASATVDTIGELAGSLRRPTNRPVPAGVQSPTPPETAPERMEVEKNRHQ
FVTPRDKFPLGQLRETGSKMFTSTTVRKSRNTIENEFKSQKVLFATPVVMSRPPVSFLPD
DSLNYSVVNTPDGAKGSKHLSPIKEQQNMAKRSTHQLFGGLDLPDKVAAPNVPAVAAPVP
VERMVESGEAQQQQPKERPIVINGKEYLVMKKLGSGGSSSVFLAKQVATGLECAVKLVNL
NGDANLVEGYLNETKMLAKLQTNENVIALYDYAHIPEASQLFLVMERGESDLHRILQGYT
SDIPLYTLMSIWYQMVQCVHYIHGEGVIHLDLKPANFLMIRGRLKLIDFGIASSISFDST
SIMKFSQAGTFNYISPEALIDTSSEMSPANSQPRIKMSKKSDIWSLGCILYLLLYKRTPF
AHIKNVVTKVNVITSPNTVIEYPPLASYYPSMLLDILKRCLRYDAKSRASTADLLEYPYH
MVIPLNK
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgcagcggaagggctgcagcaacacgccctttcaaccgaagcgagtgtccgagttgccc
cctcttgaatcggattccgattccgacggagatggaaacttaaattgtgcgatcctgaat
gattcattcctactgacgccgtcgaagtgcatcgaggaggatgacagtgtggacaagaag
atacctgccaaagcaaccctccgaacggtgacggatgccgtgccgaagtcacgcattaag
ctggaagacaagcttcctgccgcttacgctgcgccggaaggtgatccgaaaacggtcaag
cgtgccccactggttgaacgcacccagctcgatcccaagctgatcaacgattcgtcgccg
accaagtccacgcgcagccatgattctgggtatggtgcaagcgcaacagtcgacacgatc
ggcgagctggcgggatctttacgcagaccaaccaacagacccgttccggctggcgtgcaa
agcccaacaccgccggagacagcacctgaacgaatggaagtggaaaagaatcgtcatcag
ttcgtgactccacgcgacaagtttccgctcggacagctgcgggaaactggctcaaagatg
tttacctcgaccacggtgcgcaaatcacgcaacacgatcgaaaatgagttcaagtcgcag
aaggttctgttcgcgacaccggtggtaatgtcacggccaccggttagctttctccccgac
gatagtctgaactactcggtggtcaacacaccggacggagcgaagggatcgaaacatttg
tcacccatcaaggagcagcaaaatatggccaagcgatcgacgcaccagctctttggcggg
ttggacctgcctgataaggttgctgcgccgaatgtaccggctgtagccgccccggtaccg
gtcgaaaggatggttgaatccggcgaagcacaacaacagcaaccaaaggaacggccaatc
gtaatcaatgggaaggaatatctggtgatgaaaaagctaggatctggtggatcgagttcc
gtctttcttgccaaacaggttgcgacgggattggagtgtgctgttaagctcgtcaatttg
aatggagatgcaaatctggtcgaaggctatctaaacgaaacgaaaatgcttgcaaagctg
cagacgaacgagaatgtgattgctctttacgattatgcccatatccctgaagcaagccaa
ctgtttctggtgatggaacggggcgagagcgatttgcatcgaatcctgcaagggtacaca
tcggacattccgctgtacacgctgatgagcatctggtatcagatggtgcagtgcgtgcac
tacatccacggcgaaggcgtcatccatctcgatctgaaaccggccaactttctgatgatt
cgcggccggctgaaactgatcgactttggcatagcgagcagcatttcgttcgattcgacc
agtattatgaaattttcccaggccggcacatttaactacatcagcccggaggcactgatc
gacacgtcgagcgaaatgagcccggccaactcgcagccgcgcattaaaatgtcgaaaaag
tccgacatctggtcgttgggctgcatcctgtacctgttgctctacaagcggacgccgttc
gcgcacatcaaaaacgtcgtgacgaaggtgaacgttattacgagtcccaacacggtcatt
gagtatccaccgctggccagctactatccgtccatgctgctggacattctgaaacggtgc
ctgcggtacgacgccaaatcgcgtgcttccacggcggatctgctagagtatccgtatcat
atggttatcccgctgaacaaatag

DBGET integrated database retrieval system