KEGG   Anopheles gambiae (mosquito): AgaP_AGAP002086Help
Entry
AgaP_AGAP002086   CDS       T01036                                 

Definition
AGAP002086-PA
Orthology
K12655  
OTU domain-containing protein 5 [EC:3.4.19.12]
Organism
aga  Anopheles gambiae (mosquito)
Brite
Enzymes [BR:aga01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     AgaP_AGAP002086
Peptidases [BR:aga01002]
 Cysteine Peptidases
  Family C85: DUBA deubiquitinylating enzyme
   AgaP_AGAP002086
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2R
AA seq 717 aa AA seqDB search
MTIKPVVNQKSAKEETQEGTPQNVHGVGNAGVRTSHRNVVLNQLSSSESQALPREKRVLT
PHSFDSDSVHPYALSCEIRRIFEEEEEEDLGRLKRDHYHKRESREREKATGSPSYHHHVV
LQPSASGKKQSTACSSTLASAAGGGRSPKSTHQSGGAGGSLLNSHQAVVGSPGASGVDLN
AVLEEVRSGYNSGDEYIDSKDAQLTADEWKKRDEAFAKVLSERGFILHEMEEDGACLFRA
ISLQIYGDQEMHEAIRQQTMDYIYQNREYFAQFVTEDIADYVERKRANHVHGNHIEIQAM
SEMYNRSVELYCYQTEPTNIFNSDQINNGNEPFRLSYQRSSHYNAIVNPYKASVGVGLGL
AGYRPDELDIKQVADAVRMSEELEIEKTMLEDKLKTTDWEATNEEIEEQIARESYAQYCR
EARLGAGGGSSQNKSTSSTITSTEMMAACASGSQSASSYLLELRKSPPSASHGNQQQPPI
SSGMGSDRGACSSSSKNSSFELDCCSSSPSSSQQHYYYGSGASSNGNGTGSNNNSTSCSS
ECNRRKKRNINSPIEKTNSAETKKCKANGNRTSSTSSNSPRRSESPAEEKSPTPSPPSTS
STMPPPARDGTEEESSSSGSGGTGGAGGVSACALFPSSLPPSTGATRDETPMSEFYQSLL
ESSYTDDGSFGQLSEREMIQKALEESAMDFVKRGDNSKAFQEDKYGTTDEEYDSPSP
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atgactatcaaacccgtggtcaatcagaaaagtgctaaagaggaaacgcaggagggcacg
cctcagaacgtgcacggtgtggggaatgcgggcgtccgtacgtcgcaccgtaatgtggtg
cttaatcagctgtcgtcatcggaatcgcaggcactgccaagggaaaaacgggtgctaaca
ccgcacagcttcgacagtgacagcgtacacccatatgcattgtcttgcgagattcggcgg
atctttgaagaggaggaggaggaggatcttggacgtctaaagcgtgaccattaccacaag
cgtgaaagccgcgaacgggaaaaggcaaccggttcacccagctatcatcatcatgtggtg
ctgcaaccgtctgccagcggcaaaaagcagtccaccgcctgctccagcacactggccagt
gcggcgggcggtggtcgatcgcccaaaagcacccaccaatccggcggggcaggtggatcg
ctgctaaacagccaccaggctgtggtgggcagtccgggagcgtccggtgtcgatctgaac
gcggtgctggaggaggtccgctcggggtacaacagtggcgatgagtatatcgactcgaag
gacgcgcagctgacggcggacgagtggaagaagcgcgacgaagcgttcgcgaaggtcctg
tccgagcggggcttcatcctgcacgagatggaggaggacggcgcgtgcctgtttcgggcg
atatcgttgcagatctacggcgatcaggagatgcacgaagcgatccgccagcaaacgatg
gactacatttatcaaaatcgcgaatatttcgcacaattcgttaccgaagatatcgccgat
tacgtcgagcgaaagcgcgccaatcacgtgcacggcaatcacatagaaattcaagcaatg
tcggaaatgtacaaccgatccgtggaactgtattgctatcaaacggaacctaccaacatt
ttcaactcggatcaaatcaacaatggcaacgaaccgttccggctgtcctaccagcgcagc
tcgcactacaacgccatcgtcaacccgtacaaagcgtccgtcggcgtagggctcggcctg
gccggctaccggccggacgagctcgacatcaagcaggtggcggacgcggtgcgcatgagc
gaggagctcgagatcgagaagacgatgctggaggacaagctgaaaacgaccgactgggag
gcaacgaacgaagagatcgaggagcagattgcccgcgaatcgtacgcccagtactgccgg
gaggcgcggctcggggccggcggtggctccagccagaacaaaagcaccagcagcacgatc
acctcgaccgaaatgatggccgcctgtgccagcgggtcccagtcggcttcctcgtatctg
ctcgagcttcgcaaatcgccgccgtcggcaagccatggcaaccagcagcagccgcccatt
tcgtccggcatgggaagcgatcggggtgcctgctcgtccagctccaagaacagctcgttc
gagctggactgctgctcgtcctcgccgtcatcctcccagcagcattactactacggaagc
ggcgcaagctcgaacggcaatggcacgggaagcaacaataatagcaccagctgcagcagc
gaatgtaaccggcggaaaaagcgtaacattaactcaccgatcgagaaaacgaacagcgca
gaaacgaaaaagtgcaaagcgaacggcaaccgtacatccagcacgtcctcgaacagtcca
cgccgttccgaaagccctgctgaagaaaaatcccccacaccatctccaccgagcacgtcg
agcacaatgccacctccggccagagacggcacggaggaggaaagcagtagcagtggtagt
ggtggtactggtggtgctggtggcgttagtgcatgtgccctctttccatcgtccctgcca
ccatcgacgggagcaacgcgcgacgaaacgccaatgtccgagttttatcagtccctgctc
gagtcttcctacacagacgatggtagcttcggacagctgtcggaacgggaaatgatccag
aaagcgctcgaggagtcggcgatggattttgtgaagcgcggcgacaactccaaagctttc
caggaggataagtacggcacaacggacgaagagtacgattccccatcgccgtaa

DBGET integrated database retrieval system