KEGG   Anopheles gambiae (mosquito): AgaP_AGAP002119Help
Entry
AgaP_AGAP002119   CDS       T01036                                 

Definition
AGAP002119-PB
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
aga  Anopheles gambiae (mosquito)
Brite
Enzymes [BR:aga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     AgaP_AGAP002119
Protein kinases [BR:aga01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   AgaP_AGAP002119
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2R
AA seq 1483 aa AA seqDB search
MIVTPRSASLTLNAASESVVVVVVGGDRRRRCQPLDTTTVGGGGGGGGDKSSSSSSSNHS
NHNNGCDDRRDGVPIISNLLIGSPADISVAGQRQRHEAAARWRQANGRANDGHRFANCTR
REQQRSTAGTVPRGGQPESGSTYRTGVTEGGGGGAAAAAAAAAATATFAEAGTNHDDRLR
GGSAVGGEVAAGFERVEGIGGGGVGEAEGVRRSSTATATTSGQRQQQQQQQQQEPFAPKT
ASSSGDSVGGGGGGGGGGGGGRGFHFPAHQPGRQEGVDIVLPVASYVGVVGSGRRQQQQQ
QYQQQQTAPSSADDPVGGGVVVVQGGSDSSSSSTGSSNSGGGGGGGLVSGNSGGAESSAS
CSSTASSGNGIAGSVVAPDAVGGSSQFGSIGTGRAGGDASREDEGGSSGSGGSGKRILAV
NRNIDDLLFGSDLDSLINDNIIYGFKSLKVSRAQSQDQLDYQQQQQLLQQQQQQQQQPFY
HHYHSNPLHLQQHLQQQQQQQQHHLPNTAATLGYQPYQPQQQSHHPAHQQQQHQSHIGHW
IESEIIASSSNSNSSTMLADKAKQKLAAQFASGNVPDSTRQRHHAPLYGRLVTEEHLPAV
HRDIHQRSISPTSSTDIRAMEARIPVLFRDPATAPLRKLSVDLIKTYKHINEVYYAKKKR
RAQQTQGEDTSHKKERKLYNDGYDDENHDYIIKNGEKFLDRYEIDSLIGKGSFGQVVKAF
DHEERCQVAIKIIKNKKPFLNQAQIEVKLLEMMNRADAENKYYIVKLKRHFMWRNHLCLV
FELLSYNLFDLLRNTNFRGVSLNLTKKFAQQLCTALLFLSTPELNIIHCDLKPENILLCN
PKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGIPYDLAIDMWSLGCILVEMHTG
EPLFSGSNEADQINRIVEVLGMPPKHILDQAHKTRKFFEKLPSDGSYVLRKTQNQRKYKP
PGSRKLHDILGVETGGPGGRRHGEPGHSVSDYLKFKDLILRMLDYDPKTRVTPYYALQHN
FFKRTSDESTNTANTISSLSTSPSVSTQDQPSHGLSSLHQQQSSQPPSQQQTQPKAPQQQ
TLVLLAQPATVGTNGTHNNNNNNTNSSSSSSSNSSGGAVAGNGAIAGSSSVTGVSTAAGV
IVPGSNVVGSSTAPTTSSYPLAMDCDPPATVSLGGHHAGGSAAARYGNTAVSAPGAAPAP
SHYHRSRYLAQQQQQQHQQAQQGQHLQGSASHLGSSALVVGGGGGHKSYAPASLPLDLGS
HMASSLGGLVIPDHHAPAAMSGSFLAHNLSMPPGGGVVGPGSIGGMPVGGAVGYAPFSVN
EAMLMAAAAASSGAGGSVGPLGGGNSLGVIGGPIGVGSVSTVGPASLVVGGSAAAVSVGV
GVSSHHLIGGTGSSISNSSSSSSSTNGGGGGGAGLAGPLGSGTVGAGSGSASGGSSVGSG
GSGIVSSSSAKGHGRGPPGAPSDRDESSPMVGVCVQPSPVIIH
NT seq 4452 nt NT seq  +upstreamnt  +downstreamnt
atgatagtaacccctcgatcggcctcgctcacactcaacgcagcaagcgaaagcgtcgtc
gtcgtcgtcgtcggtggtgatcgtcgtcggcgttgccaacccctcgataccacgaccgtc
ggtggcggtggtggtggtggtggtgataagagtagcagcagcagcagcagcaatcacagc
aaccataacaacggctgcgacgaccggagggacggcgtccccatcattagcaacctgttg
attggcagcccagccgacatttcggttgctggacagcggcagcggcacgaagcagcggcc
aggtggcggcaagcgaacggtagagcgaacgacggccaccggttcgccaactgcacgaga
cgggagcagcaacgtagtacggcaggtaccgttccgcgcggtgggcagcccgaaagcggc
agcacgtaccgtaccggcgtgacggaaggtggtggtggtggtgcggcggcggcagcagca
gcagcggcagcgacggccacgtttgcggaagccggcacaaatcacgacgatcggctgcgc
ggtggtagtgcggttggtggagaagtagcggctggattcgaacgcgtcgaagggattggt
ggcggcggggtaggcgaagcggaaggagtgcgacgtagtagcacggcaacggcaacgacg
agcggtcagcgccagcagcagcagcagcagcagcagcaggaaccgttcgccccgaagacg
gccagcagtagtggtgatagtgtcgggggcggtggcggaggtggtggtggtggcggtggt
ggacgagggttccatttccccgcgcatcaacccggccggcaagagggagtggacatcgtc
ctgccggtcgcttcgtacgtgggagtggtgggcagtggtaggcgacagcagcagcagcag
cagtaccagcagcaacagacagcaccgtcgtccgcggacgatccggtcggtggtggagtg
gtggtagtgcagggcggcagcgacagtagcagcagtagcaccggcagcagcaacagtggt
ggtggtggtggcggcggcctcgtcagtggcaacagtggtggtgcggaaagtagtgccagt
tgcagcagcaccgctagcagcggaaacggaattgccggctcggtggttgcgccggacgcg
gtcgggggcagctcgcagttcggttcgatcggtacgggcagggcgggcggggacgctagt
cgcgaggacgagggtggctcgagcgggagcggggggagcggcaagcgcatccttgccgtg
aaccgcaacatcgacgatctgctgttcggcagcgatctggactcgctgatcaacgacaat
attatttatggcttcaaatcgctgaaggttagccgggcccaatcgcaggatcagctagac
tatcagcagcagcagcagctgttgcaacagcaacaacagcagcagcaacaaccgttctat
caccattaccattcgaatccgctgcatttgcaacagcatttacaacagcagcagcaacag
cagcagcaccacctgccgaacacagctgcgacgctcggctaccaaccgtaccagccacag
caacaatcacatcatcctgcccatcagcagcagcagcaccaatcacacatcggccattgg
atcgagtcggaaattatagcgagcagcagcaacagcaacagcagcaccatgttggccgac
aaagcgaaacagaaactggcggcccagttcgcatccggaaatgttcctgactcaacgcgg
caaaggcaccatgcgccgctctacggaagactggttacagaagaacacttacctgccgta
catcgtgatatacaccagcgttcgataagtcccacatcatcgaccgatattcgggcgatg
gaagctcggataccggtgctttttcgtgatccagcgaccgctcccctgcgaaagctaagc
gttgacctgatcaaaacctacaaacacattaacgaggtttactatgccaaaaagaagcga
agagcacagcagacccagggcgaggacacgtcccacaaaaaggagcggaagctgtacaac
gacggttacgacgacgagaatcatgactatatcattaagaatggcgagaagtttctcgat
cgatacgagatcgactcactgatcggcaagggaagcttcgggcaggtggtgaaagcgttt
gaccacgaggagcgctgccaggtggcgatcaaaatcatcaaaaacaagaaacccttccta
aaccaagcacaaattgaggtcaagctgctggaaatgatgaaccgggccgacgcggaaaat
aagtactatatcgttaagctaaagcggcacttcatgtggcgaaatcatctatgtttagta
ttcgaactgttatcctataatttattcgatctactgcgcaatacaaacttccgcggcgtc
tcactgaacctgacgaaaaagtttgcccagcaattatgtacggcgttattatttttaagt
acaccagaattaaatatcatacactgtgatttgaaacctgaaaatatactactatgtaat
ccaaaacgatcagcaattaagatagtggactttggcagctcctgtcagctgggacagcgg
atatatcagtacatacaatcacgcttctaccgatcgccagaggtactgctggggataccg
tacgacttagcaatcgacatgtggtcgctcgggtgcatcctggtcgagatgcacaccggt
gagccactgttttccggctcgaacgaagccgaccagatcaaccggatcgtggaggtgctc
ggtatgccgccgaagcacatcctcgaccaggcgcacaaaacacgcaaattcttcgagaag
ctcccgtcggacggtagctacgtgctgcgcaagacgcaaaaccagcgcaaatacaaaccg
cccggctcgcgcaagctgcacgacatactcggcgtcgagacgggcgggccgggcggccgg
cggcacggcgagcccggccacagcgtgtcggactatcttaagtttaaggacctcatcctg
agaatgctggactacgacccgaagacgcgggtcacaccgtactatgccttgcaacacaac
ttcttcaagcgaacctcggacgaaagcaccaacacggccaacacgatcagctcgctgagc
acgagcccgtcggtcagcacgcaggatcaaccgagccatggtctatcatccctgcatcag
cagcaatcgtcacagccccctagccagcagcaaacacaaccaaaagcgccacagcagcaa
acgctcgtactgctggcgcaacccgccacagtcggaacgaacgggacacacaacaacaac
aacaacaacactaacagcagtagcagcagcagcagcaacagcagtggcggtgccgtggct
gggaatggtgccatcgctggaagcagtagcgttactggtgtcagcaccgccgccggtgtg
atagtgcccggcagcaatgtcgttggctcctcaaccgcacccaccacatcatcgtacccg
cttgccatggattgtgatccaccggcgacggtcagccttggtggccaccatgccggcggt
tcggccgcggcccgatatggaaacaccgcagttagtgcgcccggagcggcgcccgcccca
tcccactatcaccggagtcgatacttagcccagcagcagcagcagcagcaccagcaagca
caacaaggacagcatttgcaaggctccgcctcgcacctaggttcgtccgcgttggtggtt
ggtggcggaggaggacacaaaagctacgcacctgcctcgttaccactcgacctaggcagc
cacatggcgtcgtcgctgggcggactggtgataccggatcaccatgcgccggccgccatg
tccggtagctttctggcgcacaacctctccatgccaccgggcggtggtgtagttgggccg
ggcagtattggcggtatgccggtgggaggagcggtcggctacgcaccgttttcggtgaac
gaagcgatgctgatggcggcggcagcggccagtagcggcgccggtggcagcgttggccca
ctcggcggtggtaacagcttgggcgtgatcggtggtccgattggtgtcgggtcggtttct
acggtcggacctgcgtcactcgtcgtcggtggatcagcagcagccgttagtgtcggtgtc
ggtgttagcagtcatcatctcatcggcggcaccggaagtagcattagcaacagtagtagt
agtagtagtagcaccaatggaggaggaggaggaggcgcaggactagcagggccgttaggg
agtgggaccgttggtgcggggtccggctcggccagcggtggtagcagtgtaggttcgggc
ggaagcggtatagttagcagtagtagtgcgaaaggacacggtcgggggccaccgggcgct
ccgagcgatcgggacgaatcatcacctatggttggtgtttgcgtgcagccgagtccagtt
atcattcactga

DBGET integrated database retrieval system