KEGG   Anopheles gambiae (mosquito): AgaP_AGAP002157Help
Entry
AgaP_AGAP002157   CDS       T01036                                 

Definition
AGAP002157-PA
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Phagosome
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:aga00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    AgaP_AGAP002157
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    AgaP_AGAP002157
Exosome [BR:aga04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AgaP_AGAP002157
  Exosomal proteins of colorectal cancer cells
   AgaP_AGAP002157
  Exosomal proteins of bladder cancer cells
   AgaP_AGAP002157
Heparan sulfate/heparin binding proteins [BR:aga00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  AgaP_AGAP002157
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2R
AA seq 396 aa AA seqDB search
MKSTLPMAGLLLLLALFAFVQQVQPLSIDPVASTELEEYIKDDFLISLRHIRPRRKFRIT
IEALFMIDFPESKNKFSFYLDRKNKRVTIDITTHSKVYSKNLILSELNESTTIKSLAFAF
HQSAITVYMNCKQSSTEELDVNLSKLFAGSDEPTVKLFRERKYPLFLDSDLDKALSRASC
QKILRRNGNHIPSRQKQTVEKMLKNKVQGELIPERNKKRDIRNWHHTAEKYKEAFHTDFS
ANRGDIPIIHGDCDENILKLLGELMKLVKELKEEVKGQRHEINYLRGLIENCAGCQQAQP
LRENCQYSNPCFPGVQCYDTSTGMRCGHCPRGYVGDGRNCRPGQTCADQPCFNGVQCYDT
VEGAQCGPCPAGYEGDGKHCRFRDACEDKPCAPGRK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcaaccctgccgatggcagggctgttgctgctgctggcactgttcgcgttcgtg
cagcaagtgcaaccgctgtcgattgacccggttgcctcgactgagctggaagaatacatt
aaggatgatttcctaatatcgctccgccacattagaccgcggcgaaagtttagaatcacc
atcgaggcactgtttatgatcgatttccctgaatcgaagaacaaattttccttctatctc
gatcgcaaaaacaagcgagtgaccatcgacatcaccacccactcgaaggtgtactcgaag
aacctcatcctgagcgagctgaacgagtcgaccacgatcaagtcgctggcgttcgcgttc
caccagagcgcgatcaccgtgtacatgaactgtaaacagtcctcgaccgaggagctggac
gtgaacctgtcgaagctgtttgcgggcagcgacgagccgacggtcaagctgttccgcgag
cgcaagtatcccctgttcctggattccgacctggacaaggcgctgagccgtgccagctgt
cagaagatactgcgccgcaacggcaaccacatcccgtcgcgccagaagcagacggtagaa
aagatgctcaagaacaaagtacaaggtgagcttataccggagcgcaacaagaagcgtgac
atccggaactggcaccacacggcggaaaagtacaaggaagcgttccacaccgacttctcg
gcaaaccgtggcgacatcccgatcattcacggtgattgtgatgagaacattctgaagctt
ctcggcgagctgatgaagctggtgaaggagctgaaggaagaggtgaaaggacagcggcat
gagatcaactacttgcgggggctgatcgagaactgtgccggttgtcagcaggcgcaaccg
ctgcgcgaaaactgccagtacagcaatccgtgcttcccaggcgtgcagtgctatgatacg
tccactggtatgcgctgtggccactgtcctcgtggatacgtcggcgatggccgaaactgt
cgtccgggtcagacctgtgcggaccagccatgcttcaatggtgtccagtgttatgacacg
gtcgagggtgcccagtgcggtccctgcccggcgggatacgagggcgacggtaagcactgc
cggtttcgggacgcctgcgaagacaaaccgtgcgcaccaggtaggaagtaa

DBGET integrated database retrieval system