KEGG   Anopheles gambiae (mosquito): AgaP_AGAP002176Help
Entry
AgaP_AGAP002176   CDS       T01036                                 

Definition
AGAP002176-PA
Orthology
K01360  
proprotein convertase subtilisin/kexin type 2 [EC:3.4.21.94]
Organism
aga  Anopheles gambiae (mosquito)
Brite
Enzymes [BR:aga01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.94  proprotein convertase 2
     AgaP_AGAP002176
Peptidases [BR:aga01002]
 Serine Peptidases
  Family S8: subtilisin family
   AgaP_AGAP002176
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2R
AA seq 655 aa AA seqDB search
MFVKKLAYLMVVVAVCLFGIGCIAATGLPGSAAKGAGGHQTGDVFTSSFLVRFKRSLDKQ
LVHEIASRNGFQNLGELPGSNGKEFHFKHTTLPLVRTRRSISHTRVLKKEPLVHTAIQQS
GFKRVKRGFRHAVPLNYIPDKAPGYGGENVPTDPYFPFQWYLKNTGQNGGKAKLDLNVLA
AWDQGITGKNITTAIMDDGVDYMHADLKFNYNAEASYDFSSNDPFPYPRYTDDWFNSHGT
RCAGEVAAARDNGICGVGVAYDSKIAGIRMLDQPYMTDLIEANSMGHEPHKIHIYSASWG
PTDDGKTVDGPRNATMRAIVQGVNEGRNGLGNIYVWASGDGGEEDDCNCDGYAASMWTIS
INSAINDGQNAHYDESCSSTLASTFSNGAKDPNTGVATTDLYGKCTTTHSGTSAAAPEAA
GVFALALEANPLLSWRDMQHLTVLTSKRNSLFDAKNRFHWTMNGVGLEFNHLFGFGVLDA
GAMVALAKKWRTVPPRYHCEAGAITQMHRIPSSGSLYLPIKTNACKGTDTEVRYLEHVQA
VITANASRRGDLELFLTSPMGTRSMILSKRANDDDRRDGFTKWPFMTTHTWGEYPQGTWM
LEATFNSQESRSGWIKEFSLVLHGTKDPPYQTLSPASPHSKLAIVKKAHEDKDGN
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atgttcgtgaagaagctcgcctacttgatggtggtggtggcggtctgcctgtttggcatt
ggctgcatcgcggcgaccggactgccgggatcggctgccaagggcgcagggggccaccag
acgggcgacgtgttcaccagctcgtttctggtgcggtttaagcgcagcctggacaagcag
ctggtacacgagattgcctcgcggaatggattccaaaatttgggcgagcttcctggcagc
aatggtaaggagtttcacttcaagcacaccaccctgccgttggtacgcaccaggcgaagc
atctcccatacgcgtgtgcttaaaaaggaaccactggtacacaccgcaatacagcagtcc
ggatttaagcgcgtcaagcgcggcttccgccatgccgtcccgctgaactacatcccggac
aaggcgcccgggtacggtggcgagaatgtgcctaccgatccgtacttcccgttccagtgg
tacttgaaaaacacgggacaaaacggcggcaaggcgaagctcgacctcaacgtgctggct
gcgtgggaccaaggcattaccgggaaaaacattaccaccgccatcatggacgacggcgtt
gattacatgcacgcggatctgaagtttaattataatgccgaagcgagttacgattttagc
agcaacgatccgttcccttacccacggtacacggacgattggttcaatagccatggcaca
cggtgcgccggtgaggtagccgccgcccgggacaacggcatctgcggggtgggcgttgcg
tacgattcgaagatcgccggcatccgaatgctggaccagccgtacatgaccgatctgatc
gaggcgaactcgatggggcacgagccgcacaagatccacatctacagcgcgtcctggggc
ccgaccgacgacggcaaaacggtggacggcccacggaacgcgacgatgcgcgcgatcgta
cagggtgtcaacgagggccggaacgggctgggcaacatctacgtgtgggcgtccggtgac
gggggcgaggaggacgattgcaactgcgacgggtatgccgcctccatgtggaccatctcg
atcaacagtgcgatcaacgatgggcagaatgcgcactacgacgagagctgcagctccacg
ctggccagcacgttcagcaatggcgcgaaggatccgaacaccggtgtggctacgacggac
ctgtacgggaagtgtacaacgacacactcgggcactagtgcggcagcaccggaagcggcc
ggagtgtttgccctcgcactggaagcaaacccattgctgtcctggcgcgatatgcagcat
ctgaccgtgctgacgtcgaagcgcaactcgctctttgacgccaagaaccggttccactgg
acgatgaatggggtcgggctggagtttaaccatctgttcgggttcggcgtgctcgacgcc
ggtgcgatggttgcgctggcgaagaaatggcgaacggtgccaccacgctaccattgcgaa
gcgggcgcaatcacccagatgcaccggataccttcgtcgggctcgctgtacctgccgatc
aagacgaacgcttgcaagggaaccgacacggaggtacgctatctggagcatgtgcaggcc
gtcatcacggcgaacgccagcagacgtggggatttggagctgttcctcacctcgccgatg
ggcactagatcaatgatactgagcaaacgggctaatgacgatgatcgacgcgatggcttc
accaaatggccgttcatgacgacccacacctggggcgaatatccgcagggcacatggatg
ttggaggccaccttcaactcacaggaaagtcgctccggctggattaaggagttttcgctc
gtgctgcacggtaccaaggacccgccgtaccaaacgctgtcaccggcttcgccccactcc
aagctggcgattgtaaagaaagctcacgaagataaggacggcaattaa

DBGET integrated database retrieval system