KEGG   Anopheles gambiae (mosquito): AgaP_AGAP002287Help
Entry
AgaP_AGAP002287   CDS       T01036                                 

Definition
AGAP002287-PA
Orthology
K15719  
protein O-GlcNAcase / histone acetyltransferase [EC:3.2.1.169 2.3.1.48]
Organism
aga  Anopheles gambiae (mosquito)
Brite
Enzymes [BR:aga01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     AgaP_AGAP002287
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.169  protein O-GlcNAcase
     AgaP_AGAP002287
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2R
AA seq 1169 aa AA seqDB search
MAETVTDAPSEPAHPGMSLQEGTDAGMLGAAGTTNTIITSTTTTTDAELLPDGGNCHTPA
EGFICGVVEGFYGRPWTTEQRKDLFRKLKQWGMDAYIYAPKDDYKHRAYWRELYTVEEAD
HLTGLIAAAHEQGINFYYALSPGLDITYSSAKEIGILKRKLDQVSQFGCKAFALLFDDIE
PEMSKPDKEVFQSFAHAQVSVTNEIFNHLNCPRFLFCPTEYCSSRAAPTVKQSEYLNTLG
SKLVRAIDILWTGPKVISKVLTVECIEEITEVLKRPPVIWDNLHANDYDQKRVFLGPYSG
RSPELIPLLRGVVTNPNCEFHANSIAIQTLAFWSKCSADTKIASSLSPDIKLETENEQGI
CEGDAPAFLSENVYHPRLALKNAIANWLPEFYQEKEAWGPITKPQPAVTMVMPIIPIIPS
VNTCMTLTSTSTTTTTTATALPMPEVNTTQLQLFADVCSTVTNVAETLPNPIMNSLVSAT
KVVTNESIPNPVVAAVNHIAIPPTIPLSSIPVPLLNMKPTESDGAEAVDCCREPANSVDM
EKVNPNGSCRPEGDAAPLLDGDAVIRDESNEQRREDDGADGQRQTITEEEAKMLDLEENE
VKMVDASEEPDDKMTVSDEQVAICQAPPALDKMVDDESDSKPDASGSVVPEPMECGSNLT
SPKHQLKTHFDDIVMSETTSTCSGTMQVESSDTSLEMAEDKNGQEKQITAGDIMLLCDLF
YLPFEHGSKALQLLSEFYWLRNNAYVLCAQRTNRGGKQRTTSTASAGGGVTPTTDGAAAA
GQPSGEDITEASNGPATDGRDLSKCDAQEWLRRSESFQTLCQSIFLLTKKIANCANKEMC
YDLFSYVWDIASVLSLLSAFVKWLALGNFPPTINSFTQGGYNWFSKGWKETFMSGDQEPW
VFRGGLVADLQRLIPLDTGNDLFLYKTPETSAVRLYSIRPYMFSDEATLYDICHRTALDG
EPMADRPAQSPLGQLIADRYLGPFLTLAPELCLVIEDHNGQTVGYACAALDAKVFVRNME
HCWIPEMCIKYPVSLAPAAEQPDGSTGGGSPEEIAGPNQAAGSRTSQMVRDSIHYFHSFQ
NDYPAAVLGKHPSLMCCRILKDHFMEDETVCKRVVTVLLAALRCHGTSFGVHVCISRSDR
FLYQFYAKLGFVEIAGTEPDPNLYMGRSF
NT seq 3510 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaacggtgacggatgcaccctcggaaccagcccatccggggatgagcctgcag
gaaggcacggatgctgggatgcttggagcggccggcacaacaaacaccatcatcaccagt
accaccaccaccaccgacgcggagttgctgcccgacggcggtaactgccatacgccggcg
gaagggttcatctgcggcgtggtggaagggttctacggccgcccgtggacaacggagcag
cggaaggatctgttccgcaagctgaagcagtggggcatggacgcgtacatctacgcaccg
aaggacgactacaagcaccgggcgtactggcgcgagctgtacacggtggaggaggcggac
cacctgaccgggctcatagcggccgcccacgagcagggcatcaacttttactacgccctg
tcgcccggtctggacatcacgtacagcagcgcgaaggagatcggcatcctgaagcgcaag
ctcgaccaggtgtcgcagttcgggtgcaaagcgttcgccctgctgttcgacgacatcgag
ccggaaatgtcgaaaccggacaaggaggtgtttcagagcttcgcccacgcccaggtgtcg
gtgacgaacgaaatcttcaaccacctgaactgtccccggtttctattctgcccgaccgag
tactgcagctcgcgggcagcgcccaccgtcaagcagtccgagtatctgaacacgctcggc
tcgaagctggtccgagcgatcgacatcctgtggacgggaccgaaggtcatctcgaaggtg
cttacggtggagtgtatcgaggagatcacggaggtgctgaagcgaccgcccgtcatctgg
gacaatctgcacgcgaacgattacgaccagaagcgcgtgtttcttggcccgtacagtggc
cggtcgccggagctgataccgctgctgcgcggtgtcgtgacgaatccgaactgcgagttt
cacgccaactccatcgccatccagacgctggcgttctggagcaagtgcagtgcggacacg
aagattgccagctcgctgtcgcccgacattaagctggagacggagaacgagcagggcatc
tgtgagggcgatgcgccggcattcctgtccgagaacgtgtaccatccacggttggcgctg
aagaatgcgatcgccaactggttgccggagttctaccaggaaaaggaagcctggggaccg
attaccaaacctcagccggctgtaacaatggtgatgcccatcattcccatcataccgtcg
gtgaacacgtgcatgacgctaacgtcgaccagcacaacgaccacgaccactgccaccgct
ctgccgatgccggaagtcaacaccacccagctgcagctgtttgcggacgtgtgcagcacc
gtcacgaacgtggcggaaacactgcccaatcccatcatgaactcgctcgtctcggcgacg
aaggtggtcaccaacgaatcgattccgaatccggtcgtggcagcggtgaaccatatcgct
attccgccgacgatcccgctctccagtattccggtgccgctgctgaacatgaaacccacg
gaaagcgacggggccgaggcggtggactgttgtcgggagccggccaacagtgtagacatg
gagaaggtcaacccgaatggttcgtgtcgccccgaaggagatgcagctccacttctggac
ggtgatgcggtgatacgggacgaatcgaatgagcagcgacgggaagatgacggcgcagac
ggtcagcgacagacgatcacggaagaggaggcaaaaatgctggacctggaggaaaacgag
gtaaagatggtggatgcaagcgaggagccggacgataagatgacggtaagcgacgaacag
gtggcaatctgtcaggcaccgccggccctggacaaaatggtagacgacgaaagtgatagc
aagccggacgcgagcgggtccgtcgtgccggaaccgatggagtgtggcagcaatctgacc
tcgcccaagcatcagctgaaaacgcacttcgacgatattgtgatgtcggaaaccacgtcg
acctgctccgggacgatgcaagtcgaaagctccgacacgtcgctagaaatggcagaagat
aaaaatgggcaggaaaaacagataaccgccggtgacataatgctgctgtgcgatctgttc
tacctgccgttcgagcacggttcgaaagcgctgcagctgctgagcgaattctactggctg
cgcaacaacgcgtacgtgctttgcgcgcagcgcacgaaccgtggcggaaagcagcgcaca
accagcacggccagtgcgggcggtggcgttacaccgaccaccgatggtgctgctgctgct
gggcaaccgtcgggcgaggatataacggaagcgagcaacgggcctgcaacggatgggcgc
gatctgagcaagtgcgacgcccaggagtggctgcgccgctcggaatcgttccaaacgctg
tgtcaaagtattttcctgctgacgaagaagatagcgaactgtgcgaacaaggaaatgtgt
tacgatttgttttcgtacgtctgggacattgccagtgtgctttcgctgctgagcgccttc
gtgaagtggctagcgttgggcaattttcctcccacgatcaattcgttcacgcagggtgga
tataattggtttagcaaaggctggaaggaaacgttcatgtccggcgaccaggaaccgtgg
gtatttcggggcggtttggtggccgacctgcaacggctgattccgctcgatacgggtaac
gatctgttcctgtacaaaacgcccgaaacgtccgccgtgcggctgtactcgatacgcccg
tacatgtttagcgatgaggccacgctgtacgacatctgccaccggacggcactggatggc
gagccgatggctgaccggccagcgcaaagccccctcggccagctgatagcggaccggtat
ctgggcccgttcctgacgctggcgcccgagctttgcctggtgatcgaggaccacaacgga
cagaccgtcgggtacgcctgcgcagcgctggatgcgaaagtgttcgtccgaaacatggag
cactgctggataccggagatgtgcatcaagtatcccgtgtcgctcgcaccggcggcggaa
cagccggatggcagcacgggtggcggcagtccggaggagatagccggccccaaccaggcg
gccggttcccgaacatcacaaatggttcgtgatagtattcactactttcacagcttccaa
aacgactatccggcggccgtgctgggcaagcatccgtcgctgatgtgctgccgcatcctg
aaggaccacttcatggaggacgagacggtgtgcaagcgggtggtgacggtactgctggcg
gcactgcgctgccacggcacttccttcggcgtgcacgtgtgcatcagtcgtagcgatcgg
tttttgtaccagttttatgcgaagcttggctttgtggagattgccggtaccgagccggac
ccgaacctgtacatgggccggagcttctaa

DBGET integrated database retrieval system