KEGG   Anopheles gambiae (mosquito): AgaP_AGAP002397Help
Entry
AgaP_AGAP002397   CDS       T01036                                 

Definition
AGAP002397-PA
Orthology
K13278  
60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
aga  Anopheles gambiae (mosquito)
Brite
Enzymes [BR:aga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     AgaP_AGAP002397
    3.1.1.47  1-alkyl-2-acetylglycerophosphocholine esterase
     AgaP_AGAP002397
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     AgaP_AGAP002397
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2R
AA seq 692 aa AA seqDB search
MDVVDQQPTTPAPSPDSEDDDTPLAIKLKTQNGGNAPAGPATVPPAHSPWKRKQLVDVNP
HGSLDLSKLSMRRNSSYGKLPSEAPEAKVLVIYTGGTIGMMRNEKNALEPRPYEFVRKIR
QYPNMHDDGYASKRYGPAKNMAPLVLPYVEGQHRRILYQISEYEPLLDSSNMSISDWVRI
ATDIRQSYEFFDGFVILHGTDTLSYTASALSFMFENLGKTIIITGSQIPIFETRTDGKDN
FTSALILAGNYVLPEVCIFFNSRLFRGNRTIKVSSESLDAFNSPNAAPLAKMGINVEVDY
RVIFRPCTVDKFTVHLQMDENVGLLRLFPSISVATVNAFLRAPMRGVVLQTYGAGNFPTN
RADLIAALKEANERQVLIVNCTQCNEGAVCDLYETGRQLQEIGIIPGYDMTPEAALAKLS
YVLSKQEWDWETKKKMMKSNLRGELTCEKPPEMQEYDLIDAVARTLHLTSTKELGQLKSS
LFPAMVSTAVLAGDVTKLTNLKNYGANMSAENYDHRTALHVACCEGNIEMVQYLLQNGAA
VHIRDRYDRTPLMDAIMHDHHQAIRLLIKCGAHLTGSIRAIGDGLCAAAARNQQARLESY
RIAGADLSQEDSCGRTALHVAALYGHVEIVQYLLKNYAEPNAIDYLGLTPLDYALKANSE
SVVPVLERHEAVRGEELSFDADKRLQMKDSFD
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atggacgtggtagaccagcagcctaccacccctgccccatcgcccgacagcgaagacgat
gacacgccactcgccattaagttgaagacgcaaaacggtggaaacgcaccggccggtccc
gcgaccgttccaccggcccactcgccctggaagcgcaaacaactggttgacgtgaatccg
cacggcagcctggacctgagcaagctgtcgatgcggcgaaactcgagctacggcaagctg
ccgtcggaggcgcccgaagcgaaggtgctcgtcatctacaccggcggcacgatcggcatg
atgcgaaacgagaagaatgcgctggaaccacggccgtacgagtttgtgcgcaaaatacgc
cagtacccgaacatgcacgacgacgggtacgcaagcaagcggtacgggccggcgaaaaat
atggccccattggtgctgccgtacgtggaaggacagcaccgtcgcatactgtaccaaatc
tccgagtacgagccactgctcgattcctccaacatgagcatctcggactgggtgcgcatc
gcgaccgacatacgccagtcgtacgagtttttcgacgggttcgtgatactgcacggtacc
gatacgctgtcctacaccgcgtccgccctgtcgtttatgtttgaaaatttgggcaaaacc
atcatcatcaccgggtcgcagataccgatctttgagacgcgcacggacggcaaggacaac
tttacgtccgcgctgatcctggcggggaattatgtgctgcccgaggtgtgcatcttcttc
aacagccggctgtttcgcggtaaccgcacgatcaaggttagcagcgagtcgctggacgcg
ttcaattcgcccaatgcggccccgctcgccaagatgggcatcaacgtggaggtggactat
cgggtcatctttcggccgtgcacggtggacaagtttacggtgcacctgcagatggacgag
aacgtggggctgttgcggctgtttcccagcatctcggtcgcgactgtcaatgcgtttctg
cgggcgccgatgcgtggcgtggtgctgcagacgtacggtgcgggcaattttcccaccaac
cgggcagatctgatcgcggccctgaaggaggcgaacgagcggcaggtgctgatcgtgaac
tgcacccagtgcaacgagggtgcggtgtgcgatctgtacgaaacgggccggcagctgcag
gagattggcatcataccggggtacgatatgacgccggaagcggcactggccaagctgtcg
tacgtgctgagcaagcaggagtgggactgggagacgaagaagaagatgatgaagagtaat
ctgcgcggagagctcacctgtgaaaagccgccggaaatgcaagagtacgatctgatcgat
gccgttgcacgtacgctgcatcttacgtccaccaaagaactgggacagctaaagtcttcc
ctctttccggcgatggtcagcacggccgtgctggctggcgatgtgacaaagctgacgaac
ctgaagaactacggtgccaacatgtcggccgaaaactacgaccaccggacggcactgcac
gtggcgtgctgcgagggcaacatcgagatggtgcagtatctgttgcagaacggtgccgcc
gtacacatacgcgaccggtacgatcgcacaccgctgatggatgcgatcatgcacgaccac
catcaggcgatccggttgctgatcaagtgcggtgcccatctgaccggctcgatacgggcg
atcggcgatgggctgtgtgcggccgcggcccgtaaccagcaagccagactggaatcgtac
cgcattgccggtgccgacctgtcgcaggaagactcgtgcggccgtaccgcactgcacgtg
gcggcgctgtacgggcacgtggagattgtgcagtatctgctgaagaactatgccgaaccg
aacgcgatcgactatctcgggctgacgccgctcgactacgcgctgaaggctaactcggag
tcggtcgtgccggtgctggagcgccacgaggcggtgcggggcgaggagctgtcgttcgat
gcggacaagcggctccagatgaaggattcgttcgactaa

DBGET integrated database retrieval system