KEGG   Anopheles gambiae (mosquito): AgaP_AGAP002518Help
Entry
AgaP_AGAP002518   CDS       T01036                                 

Definition
AGAP002518-PA
Orthology
K12657  
delta-1-pyrroline-5-carboxylate synthetase [EC:2.7.2.11 1.2.1.41]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:aga01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:aga00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2R
AA seq 791 aa AA seqDB search
MMSFLRMFDRTGKVLRAGQQRHFSIVGSPSVSAYLMQQARKAKNVNRTLHGLHERKQATF
SERNQLKYARRLVVKLGSAVITREDEHGLALGRLASIVEQVAEYHVEGRECIMVTSGAVA
FGKQRLTQELIMSLSMRETLSPTDHTRQDAGTLVEPRAAAAVGQSGLMSLYDAMFAQYGI
KIAQVLVTEPDFYNEETRKNLFSTLSELIHLNIVPIINTNDAVVPPMFIVDQEVSATGKK
RGIRIKDNDSLAALLAAEIHADLLILMSDVDGIYNKPPWEDGARLMHTYTAGDKNLIKFG
EKSKVGTGGMNSKVMAATWALDRGVSVVICNGMQDKAIKSILTGRKVGTFFTESTAEKAT
PVEQIAENARNGSRVLQNLTAAERAQAVNTLADLLISRQSQILEANAKDLDEAKKSGLAK
PLLSRLSLTPSKLESLAKGLKQIADDSHRNVGRVVKRTKLADGLELKQVTVPIGVLLVIF
ESRPDSLPQVAALAMASGNGLLLKGGKEAAHSNRALMELVKESLAATGASNAISLVSTRE
EISDLLSMDEHIDLIIPRGSSELVRSIQEKAQHIPVMGHAEGICHVYVDREADLDKALKI
IRDSKCDYPAACNAMETLLIHEDLLQNSSFFTDVCNMLKREGVKINSGPKLNQMLTFGPP
QAKSLKFEYGALECSIEVVKNLEEAIDHVHTYGSGHTDVIVTENPTSATYFQSNVDSACV
FHNASSRFADGFRFGLGAEVGISTARIHARGPVGVEGLLTTKWILSGVDHTASEFTDGSR
AWLHQSLPTDQ
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
atgatgagcttcctaaggatgtttgaccgcaccggaaaggtgttgcgcgccggccagcag
cgtcacttttccatcgtgggcagcccgagcgtcagcgcgtaccttatgcagcaggcaaga
aaggcgaaaaacgttaaccgcaccctgcacggtctgcacgagcgcaagcaggcgacattc
agcgagcgcaaccagctaaagtacgcccggcggctggtggtgaagctgggcagcgcggtc
attacgcgcgaggacgagcacggtctcgcgctgggccggctggcctcgatcgtcgagcag
gtggccgaataccacgtggagggccgggagtgcatcatggtcacgagcggtgcggtcgcg
ttcggcaagcagcgcctgacgcaggagctgatcatgtccctgtcgatgcgcgaaaccctt
tcaccgacggaccacacgcgccaggacgcgggcacactggtggaaccgagggcggccgcc
gccgtcggccagtccggcctgatgtcgctgtacgatgcgatgttcgcccagtacggcatc
aagatcgcgcaggtgctcgtgaccgagccggacttttacaacgaggaaacgcgcaaaaac
ctgttcagcacgctgtccgagctgatccacctgaacatagtgccgatcatcaacacgaac
gatgcggtggtgccgccgatgttcatcgtcgaccaggaggtgtcggccaccggcaagaag
cggggcatccggatcaaggacaacgacagtctggcggcactgctcgcggccgagattcat
gccgacctgttgatactgatgtcggacgtggacggcatctacaacaagccgccgtgggag
gatggcgcgcggctcatgcacacctacacggccggcgacaagaatctgatcaagttcggc
gaaaagtccaaggtcggtacgggcggcatgaactcgaaggtgatggcggcgacctgggca
ctggaccgcggggtcagcgtggtcatttgcaacggcatgcaggacaaggcgatcaagagc
atacttaccgggcgcaaggtgggaacgttctttaccgagtccaccgccgagaaggcgacc
cctgtcgagcagattgcggaaaatgcacgcaatggcagccgagtgctgcagaatcttacc
gccgccgaacgggcacaggccgtcaacacactggccgacctactcatctcgcgacagtcg
caaattctcgaagcgaacgcgaaagatctggacgaggcgaagaagtcggggctggccaaa
ccgctgctttcccgactgtccctgacgccctccaagctggaaagcttggccaaaggattg
aagcagattgcggacgacagccaccggaacgtcgggcgtgtagtgaagcgcaccaagctg
gccgacgggctggaactgaagcaggtcaccgtgccgatcggggtgctgctggtcatattc
gagtcccggccggactcgctgccccaggtggccgccctcgcgatggcgtccggcaatggg
ctgctgctcaagggcggcaaggaggcagcccacagcaaccgagccctgatggagctggtg
aaggaatcacttgccgcgactggcgcctcgaacgcgatctcgctggtgtcgacgcgcgaa
gagattagcgatctgctgtcgatggacgagcacatcgatctgatcataccgcgcggttcg
agcgagctggtgcgcagcatccaggagaaggcccagcacatcccggtgatggggcacgcg
gaaggcatctgccacgtgtacgtcgatcgggaggcggatctcgacaaggcgctgaaaatc
attcgcgactccaagtgcgactatccggccgcttgtaacgccatggagacgctgctcatt
cacgaggacctcctgcagaacagttccttcttcaccgacgtgtgcaacatgctgaagcgc
gagggcgtcaagatcaactccggcccgaagctgaaccagatgctgaccttcggcccgccc
caggccaagtcgctcaagttcgagtacggtgcgctggagtgcagcatcgaggtggtgaaa
aatctcgaagaagccatcgaccacgtgcacacgtacggcagcggccacaccgatgtgatc
gtaacggaaaatcccacgtcggccacctacttccagagcaatgtggacagtgcgtgcgtg
ttccacaacgctagcagccggttcgcggacggcttccggttcgggctcggcgcggaggtg
ggcatttccaccgcaagaatacacgcccgcggccctgtcggtgtcgagggactgctcacg
acgaagtggatcctgagcggcgttgaccatacggcgtcggagtttaccgacggatcgcgt
gcctggctccatcagtcgctaccgaccgaccagtag

DBGET integrated database retrieval system