KEGG   Anopheles gambiae (mosquito): AgaP_AGAP002518Help
Entry
AgaP_AGAP002518   CDS       T01036                                 

Definition
(RefSeq) AGAP002518-PA
  KO
K12657  delta-1-pyrroline-5-carboxylate synthetase [EC:2.7.2.11 1.2.1.41]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
aga00330  Arginine and proline metabolism
aga01100  Metabolic pathways
aga01230  Biosynthesis of amino acids
Module
aga_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:aga00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    AgaP_AGAP002518
Enzymes [BR:aga01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.41  glutamate-5-semialdehyde dehydrogenase
     AgaP_AGAP002518
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     AgaP_AGAP002518
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AA_kinase Aldedh
Motif
Other DBs
NCBI-GeneID: 1273445
NCBI-ProteinID: XP_312421
VectorBase: AGAP002518
UniProt: Q7QC97
Position
2R
AA seq 791 aa AA seqDB search
MMSFLRMFDRTGKVLRAGQQRHFSIVGSPSVSAYLMQQARKAKNVNRTLHGLHERKQATF
SERNQLKYARRLVVKLGSAVITREDEHGLALGRLASIVEQVAEYHVEGRECIMVTSGAVA
FGKQRLTQELIMSLSMRETLSPTDHTRQDAGTLVEPRAAAAVGQSGLMSLYDAMFAQYGI
KIAQVLVTEPDFYNEETRKNLFSTLSELIHLNIVPIINTNDAVVPPMFIVDQEVSATGKK
RGIRIKDNDSLAALLAAEIHADLLILMSDVDGIYNKPPWEDGARLMHTYTAGDKNLIKFG
EKSKVGTGGMNSKVMAATWALDRGVSVVICNGMQDKAIKSILTGRKVGTFFTESTAEKAT
PVEQIAENARNGSRVLQNLTAAERAQAVNTLADLLISRQSQILEANAKDLDEAKKSGLAK
PLLSRLSLTPSKLESLAKGLKQIADDSHRNVGRVVKRTKLADGLELKQVTVPIGVLLVIF
ESRPDSLPQVAALAMASGNGLLLKGGKEAAHSNRALMELVKESLAATGASNAISLVSTRE
EISDLLSMDEHIDLIIPRGSSELVRSIQEKAQHIPVMGHAEGICHVYVDREADLDKALKI
IRDSKCDYPAACNAMETLLIHEDLLQNSSFFTDVCNMLKREGVKINSGPKLNQMLTFGPP
QAKSLKFEYGALECSIEVVKNLEEAIDHVHTYGSGHTDVIVTENPTSATYFQSNVDSACV
FHNASSRFADGFRFGLGAEVGISTARIHARGPVGVEGLLTTKWILSGVDHTASEFTDGSR
AWLHQSLPTDQ
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
atgatgagcttcctaaggatgtttgaccgcaccggaaaggtgttgcgcgccggccagcag
cgtcacttttccatcgtgggcagcccgagcgtcagcgcgtaccttatgcagcaggcaaga
aaggcgaaaaacgttaaccgcaccctgcacggtctgcacgagcgcaagcaggcgacattc
agcgagcgcaaccagctaaagtacgcccggcggctggtggtgaagctgggcagcgcggtc
attacgcgcgaggacgagcacggtctcgcgctgggccggctggcctcgatcgtcgagcag
gtggccgaataccacgtggagggccgggagtgcatcatggtcacgagcggtgcggtcgcg
ttcggcaagcagcgcctgacgcaggagctgatcatgtccctgtcgatgcgcgaaaccctt
tcaccgacggaccacacgcgccaggacgcgggcacactggtggaaccgagggcggccgcc
gccgtcggccagtccggcctgatgtcgctgtacgatgcgatgttcgcccagtacggcatc
aagatcgcgcaggtgctcgtgaccgagccggacttttacaacgaggaaacgcgcaaaaac
ctgttcagcacgctgtccgagctgatccacctgaacatagtgccgatcatcaacacgaac
gatgcggtggtgccgccgatgttcatcgtcgaccaggaggtgtcggccaccggcaagaag
cggggcatccggatcaaggacaacgacagtctggcggcactgctcgcggccgagattcat
gccgacctgttgatactgatgtcggacgtggacggcatctacaacaagccgccgtgggag
gatggcgcgcggctcatgcacacctacacggccggcgacaagaatctgatcaagttcggc
gaaaagtccaaggtcggtacgggcggcatgaactcgaaggtgatggcggcgacctgggca
ctggaccgcggggtcagcgtggtcatttgcaacggcatgcaggacaaggcgatcaagagc
atacttaccgggcgcaaggtgggaacgttctttaccgagtccaccgccgagaaggcgacc
cctgtcgagcagattgcggaaaatgcacgcaatggcagccgagtgctgcagaatcttacc
gccgccgaacgggcacaggccgtcaacacactggccgacctactcatctcgcgacagtcg
caaattctcgaagcgaacgcgaaagatctggacgaggcgaagaagtcggggctggccaaa
ccgctgctttcccgactgtccctgacgccctccaagctggaaagcttggccaaaggattg
aagcagattgcggacgacagccaccggaacgtcgggcgtgtagtgaagcgcaccaagctg
gccgacgggctggaactgaagcaggtcaccgtgccgatcggggtgctgctggtcatattc
gagtcccggccggactcgctgccccaggtggccgccctcgcgatggcgtccggcaatggg
ctgctgctcaagggcggcaaggaggcagcccacagcaaccgagccctgatggagctggtg
aaggaatcacttgccgcgactggcgcctcgaacgcgatctcgctggtgtcgacgcgcgaa
gagattagcgatctgctgtcgatggacgagcacatcgatctgatcataccgcgcggttcg
agcgagctggtgcgcagcatccaggagaaggcccagcacatcccggtgatggggcacgcg
gaaggcatctgccacgtgtacgtcgatcgggaggcggatctcgacaaggcgctgaaaatc
attcgcgactccaagtgcgactatccggccgcttgtaacgccatggagacgctgctcatt
cacgaggacctcctgcagaacagttccttcttcaccgacgtgtgcaacatgctgaagcgc
gagggcgtcaagatcaactccggcccgaagctgaaccagatgctgaccttcggcccgccc
caggccaagtcgctcaagttcgagtacggtgcgctggagtgcagcatcgaggtggtgaaa
aatctcgaagaagccatcgaccacgtgcacacgtacggcagcggccacaccgatgtgatc
gtaacggaaaatcccacgtcggccacctacttccagagcaatgtggacagtgcgtgcgtg
ttccacaacgctagcagccggttcgcggacggcttccggttcgggctcggcgcggaggtg
ggcatttccaccgcaagaatacacgcccgcggccctgtcggtgtcgagggactgctcacg
acgaagtggatcctgagcggcgttgaccatacggcgtcggagtttaccgacggatcgcgt
gcctggctccatcagtcgctaccgaccgaccagtag

DBGET integrated database retrieval system