KEGG   Anopheles gambiae (mosquito): AgaP_AGAP002608Help
Entry
AgaP_AGAP002608   CDS       T01036                                 

Definition
AGAP002608-PA
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:aga00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AgaP_AGAP002608
Enzymes [BR:aga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     AgaP_AGAP002608
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2R
AA seq 328 aa AA seqDB search
MSSDGDDYDVLVFGSCIVDFISYVPRLPKVGETLHGTRFATGNGGKGANQCVAAARLGSR
TAFFGKLGDDPWGAAYRTALAAEGVNVEQVDLLPGESTGIAQINVADNGDNQIVIVTGAN
KRLAPVDAFRRPELFVRARVLVCQLETPIDGTIAAMQSFRGISILNAAPADTNLPRVILS
LPSIFCVNETEAALIAGMPSVADVQQAKVATRKLQTMGCKTVIVTLGEKGAVFARALDDN
GDGQVYHVKPLKVDKVVDTTGAGDAFIGALAHCLANYPDAKLGNCIAAANRVAAWSVQIP
GTQSSFPRADEIELPADLATLQDQWGCV
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccgatggagacgattacgatgtgctcgtctttggatcgtgcatagtggatttt
ataagctacgtgccgcgtttgcccaaggtcggcgaaaccctccatggcacccggtttgcg
acgggcaatggtggcaagggcgcgaaccagtgtgtggccgccgcccggctcggcagccgt
accgctttcttcggcaagctgggtgacgatccgtggggtgcggcctaccgcactgccctg
gccgcggaaggtgtcaacgtggagcaggtcgatctgctgcccggcgaaagcaccggtatc
gcacagatcaacgtagccgacaatggggacaatcagatcgtcatcgtgaccggtgcgaac
aaacgtctcgccccggtggatgcgttccgccggccggaacttttcgtgcgggcgcgcgtg
ctggtgtgccagctggagacaccgatcgatgggacgatcgctgccatgcaatcgttccgg
ggcatctcgatcctgaatgcggccccggcggacacgaatctgccccgtgtgatactatcc
ctcccgagcatattctgcgtgaacgaaacggaagccgcactaatagcgggcatgccgagt
gtggccgacgttcaacaggcgaaagtggccacccgcaagctgcagaccatgggatgcaaa
acggtcatcgtaacgctgggcgaaaagggagccgtctttgcgcgagcactggacgataat
ggcgacggacaagtgtaccacgtgaagccgctgaaggtggacaaggtcgtggatacaacg
ggtgctggtgatgcatttatcggtgcactggcgcattgcctagcgaactatcccgatgca
aagttgggaaattgtattgcggccgccaatcgggtggccgcatggtccgtacagatcccc
ggcacacagagcagctttccgcgggcggatgagatagagctgccggccgatttggccacc
ctgcaggaccagtggggctgtgtttga

DBGET integrated database retrieval system