KEGG   Anopheles gambiae (mosquito): AgaP_AGAP002674Help
Entry
AgaP_AGAP002674   CDS       T01036                                 

Definition
AGAP002674-PA
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:aga00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    AgaP_AGAP002674
Enzymes [BR:aga01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     AgaP_AGAP002674
Glycosyltransferases [BR:aga01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   AgaP_AGAP002674
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2R
AA seq 733 aa AA seqDB search
MVTTVAAGEKERSGSEQAAENVSKMSSRKSKADEPSDKSEPKSWWWLLFGVILLLTIGTR
FYNVTVPDHVCWDETHFGKMGSWYINRTFFFDVHPPLGKMLIGLSGYLTGYDGTYPFDKP
GDKYNGTHYEGMRIFCTALGAAVVPMSFHTVWDMTGSLTASTFAAAYILFDIGMLILNRY
ILLDPPLIFFMTASVMGMARVSRLTREAASFTRAWWVWLALTGAMLACTISVKFVGLFVV
LLVGLHTASDLWDVLGDLSLPITHTVRQLAARAVTLILLPVLLYASFFYIHLAVLNRSGS
GDGFYSSGFQSNLVGNSLYNVSMPRQVAYGAVVTLKNHKTGGGYLHSHNHLYPKGFGARQ
QQVTTYSHKDENNRWLIKPYDKQTVENVTLIRHGDLVRLEHVQTRRNLHSHREQGPVTKK
HLQVTCYGEEGQGDTNDVWMVQIVGGKAGQVVETVTSRLTFYHYIERCVLTTTNKQLPKW
GFEQQEVTCNPNIRDKAAQWNVEDNQFDKLPSVNFQVYAPGFISRFFESHAVMLQGNAGL
KPKEGEVTSRPWQWPINYRGQFFSGSDHRVYLLGNPIIWWSNLVFLALFLIIFGVEIIRY
QRNSAASPPDTARTCPAPPAADATKWKLLRAAVWLFGGWLIHYLPFYAMGRVLYFHHYFP
ALVFNSMLAGVMLDYITGRLPGWLRHACLGTAMAGLVYSFVLFSPLAYGMSGPFSHEPNS
TLASLKWLSSWEF
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atggtgacgacggtggcagcaggcgaaaaagaaagatccggttcggaacaagcagctgaa
aatgtgtcgaaaatgagcagtaggaagagcaaggcagatgagccaagtgacaaaagtgaa
ccaaaaagctggtggtggctgctctttggagtgattctgctgctgactatcggcacgcgc
ttctacaacgtcaccgtgccggaccacgtgtgctgggatgagacacatttcggcaagatg
ggcagctggtacatcaaccggacgttcttcttcgacgtgcatccgccgctcggcaagatg
ctgatcggtctttccggctaccttaccgggtacgatggcacctacccgttcgacaagccc
ggcgataagtacaacggtacccactacgaaggaatgcgtatcttctgtacggcgctcggg
gcagcagtcgtgccgatgtccttccacaccgtctgggacatgacgggctcgctgaccgcg
tccacgtttgcggccgcctacatcctgttcgacattggcatgctcatcctgaaccgctac
atcctgctcgacccgccgctgatcttcttcatgaccgcctccgtcatggggatggcgcgc
gtgtcgcggctgacccgcgaggcggccagcttcacccgcgcctggtgggtgtggctcgcg
ctcaccggcgcgatgctggcctgcaccattagcgtgaagtttgtcggcctgttcgtggtg
ctgctcgtcggcctgcacacggccagcgatctgtgggacgtgctcggcgacctttcgctg
cccatcacgcacaccgtccggcagctggcggcccgtgccgttacgctcattctgttgccc
gtcctgctgtacgccagcttcttctacatccatctggccgtgctgaaccgcagcggcagc
ggcgacgggttctacagctccggctttcagtcgaacctggtcggcaactcgctgtacaac
gtgtcgatgccgcggcaggtggcttacggtgcggtcgtgacgctgaaaaaccacaagacg
ggcggcggctacctgcactcccacaatcacctgtacccgaaggggttcggggcccgccag
cagcaggtcacgacgtacagccacaaggacgagaataaccggtggctcatcaagccgtac
gacaagcagacggtcgagaacgtgacgctgatcaggcacggcgatttggtgcgcctcgag
catgtgcagacgcggcgcaatctgcactcgcaccgtgagcagggaccggtgacgaagaag
catctgcaagttacgtgctacggagaggagggccaaggagacacgaacgacgtgtggatg
gtgcagatcgtgggcggcaaggcgggccaggtggtcgaaaccgttacgagccggctcacc
ttctaccactacattgagcgctgcgtgctcaccaccaccaacaagcagctgcccaagtgg
ggcttcgagcagcaggaggtgacctgcaatccgaacattcgcgacaaagccgcccaatgg
aacgtggaggacaatcagtttgacaaattgccgagcgttaactttcaggtttatgcgccc
ggcttcattagtcgcttcttcgagtcgcacgccgtcatgctgcagggcaacgccgggctg
aagccgaaagagggtgaagtcaccagccgaccgtggcaatggcccatcaactatcggggt
cagttcttctccggttccgaccatcgcgtgtatttattgggcaacccaatcatctggtgg
agcaatttggtatttttagcactctttttaatcatcttcggcgtggagattatcagatat
caacgcaactcggccgccagcccaccggacacggcccggacgtgcccagccccaccggca
gcggacgctaccaaatggaaattgctgcgtgctgctgtatggctgtttggcggctggttg
atccactaccttcccttctacgcgatgggtcgagtcctctacttccatcactacttcccg
gcactggtcttcaactccatgctcgccggtgtaatgctcgattacattacgggccgattg
ccgggctggttgcggcacgcctgcctgggcacggcgatggcggggctggtgtacagcttc
gtgctgttctcgcccctcgcctacggcatgagcggtcccttcagccacgaacccaactcg
acgctggcctcgctcaagtggctgagcagctgggagttttga

DBGET integrated database retrieval system