KEGG   Anopheles gambiae (mosquito): AgaP_AGAP002686Help
Entry
AgaP_AGAP002686   CDS       T01036                                 

Definition
AGAP002686-PA
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
FoxO signaling pathway
Regulation of autophagy
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:aga00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    AgaP_AGAP002686
   04150 mTOR signaling pathway
    AgaP_AGAP002686
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    AgaP_AGAP002686
Enzymes [BR:aga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     AgaP_AGAP002686
Protein kinases [BR:aga01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   AgaP_AGAP002686
Mitochondrial biogenesis [BR:aga03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    AgaP_AGAP002686
  Mitophagy factors
   Other mitophagy factors
    AgaP_AGAP002686
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2R
AA seq 565 aa AA seqDB search
MADKGSQPGGTPQPLVKIGHYILGATLGTGSFGKVKIGEHQVTKHKVAVKILNRQKIKSL
DVVGKIRREIQNLKLFRHPHIIKLYQVISTPTDIFMIMEYVSGGELFDYIVKNGKLQESE
ARRFFQQIISGVDYCHRHMIVHRDLKPENLLLDHNRHVKIADFGLSNMMLDGEFLRTSCG
SPNYAAPEVISGKLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFRKIKSGVFPIPE
YLNKQVVSLLCQMLQVDPLKRATVEEIKKHEWFQKDLPAYLFPSPVEQDSSVVDTNAIRE
VCEKFSVKEHEVHNALLSGDPHDQLAIAYHLIIDNKRIADEAAKAELKEFYVAGSPPPPG
ADSKFGTPLGPGSIAPTQAGTPSEPFKSPSIHPERIAPLRERPVTAAQNMPVPTLSTMSP
SAVMPIDKHRGTPVKRAKWHLGIRSQSKPNDIMLEVYRAMKALDFEWKIINPYHVRVRKY
NARNDKHVKMSLQLYQVDPKNYLLDFKSLTNDEVEQGDDVIMESLTPPPPVGFGGMGIPS
NHQPSGHHTMEFFEMCGALIAQLAR
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atggccgataaaggttcgcagccgggcgggacgccccagccgctggtgaagataggccac
tacatactgggcgctacccttggcacgggctcgttcggaaaggtcaagattggcgagcac
caggtgacgaagcacaaggtggcggtgaagatactgaaccggcagaagatcaaaagcctg
gacgtggtgggcaagattcggcgcgagatccagaacctgaagctgttccgccatccgcac
atcatcaagctgtaccaggtgatctcgacgccgaccgacattttcatgatcatggagtac
gtgagcgggggcgagctgttcgactacatcgtcaagaacggcaagctgcaggagtcggag
gcgcgccgcttcttccagcagatcatttccggcgtcgactactgccaccggcacatgatt
gtgcatcgcgatttgaagccggaaaacttgctgctcgatcacaatcgtcacgtgaagatt
gcagatttcggactatcgaacatgatgctggatggcgagtttttgcgcacctcgtgcggc
tcgccaaactacgccgcaccggaggtaatctccggtaagctgtacgccggaccggaggtg
gacatttggtcgtgcggcgtcatactgtacgcgctgctctgcggcacgctgccgttcgat
gacgagcacgtgccgacgctgttccgcaagatcaagtcgggcgtgtttcccattccggag
tatctgaacaagcaggtggtgagcctgctgtgccagatgctgcaggtcgatccgctgaag
cgcgcgacggtggaggagatcaagaagcacgaatggttccagaaggatctgccggcgtac
ctgttcccgtcgccggtcgagcaggacagcagcgtggtggacacgaacgcgatccgcgag
gtgtgcgagaagttcagcgtgaaggagcacgaggtacacaatgcgctgctgagcggcgac
ccgcacgatcagctcgcaatcgcgtaccatctgatcatcgacaacaagcgcatcgcggac
gaggcggccaaggcggagctgaaggagttttacgtggccggcagtccgccaccgcccggt
gcggacagcaagttcggcacgccgctcggcccgggctcgatcgccccgacccaggccggc
acgccgagcgagccgttcaaatcgccctcgatacacccggaacgcattgcaccgctgcgg
gagcggccggtcacggcggcccagaacatgccggtgcccacgctcagcaccatgtcgccg
tcggccgtgatgccgatcgacaagcatcgcggcactccggtcaagcgggccaagtggcac
ctggggatacggtcgcagtcgaaaccgaacgacatcatgctggaggtgtaccgcgcgatg
aaggcgctcgactttgagtggaaaatcatcaacccgtaccatgtgcgcgtgcgcaagtac
aatgcgcgcaacgacaagcacgtgaagatgtcgctccagctgtaccaagtcgatccgaag
aactatctgctggactttaagtcgctgacgaacgacgaggtggagcagggcgacgatgtg
atcatggagagcctgacgccaccgcccccggtcgggttcggggggatgggcattccctcc
aaccatcagccgagcggccaccacacgatggagtttttcgagatgtgcggtgcgctgatt
gcgcagctggcccgctaa

DBGET integrated database retrieval system