KEGG   Anopheles gambiae (mosquito): AgaP_AGAP002686Help
Entry
AgaP_AGAP002686   CDS       T01036                                 

Definition
AGAP002686-PA
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
FoxO signaling pathway
Regulation of autophagy
mTOR signaling pathway
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:aga04068]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:aga04150]
Cellular Processes; Transport and catabolism; Regulation of autophagy [PATH:aga04140]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
Position
2R
AA seq 565 aa AA seqDB search
MADKGSQPGGTPQPLVKIGHYILGATLGTGSFGKVKIGEHQVTKHKVAVKILNRQKIKSL
DVVGKIRREIQNLKLFRHPHIIKLYQVISTPTDIFMIMEYVSGGELFDYIVKNGKLQESE
ARRFFQQIISGVDYCHRHMIVHRDLKPENLLLDHNRHVKIADFGLSNMMLDGEFLRTSCG
SPNYAAPEVISGKLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFRKIKSGVFPIPE
YLNKQVVSLLCQMLQVDPLKRATVEEIKKHEWFQKDLPAYLFPSPVEQDSSVVDTNAIRE
VCEKFSVKEHEVHNALLSGDPHDQLAIAYHLIIDNKRIADEAAKAELKEFYVAGSPPPPG
ADSKFGTPLGPGSIAPTQAGTPSEPFKSPSIHPERIAPLRERPVTAAQNMPVPTLSTMSP
SAVMPIDKHRGTPVKRAKWHLGIRSQSKPNDIMLEVYRAMKALDFEWKIINPYHVRVRKY
NARNDKHVKMSLQLYQVDPKNYLLDFKSLTNDEVEQGDDVIMESLTPPPPVGFGGMGIPS
NHQPSGHHTMEFFEMCGALIAQLAR
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atggccgataaaggttcgcagccgggcgggacgccccagccgctggtgaagataggccac
tacatactgggcgctacccttggcacgggctcgttcggaaaggtcaagattggcgagcac
caggtgacgaagcacaaggtggcggtgaagatactgaaccggcagaagatcaaaagcctg
gacgtggtgggcaagattcggcgcgagatccagaacctgaagctgttccgccatccgcac
atcatcaagctgtaccaggtgatctcgacgccgaccgacattttcatgatcatggagtac
gtgagcgggggcgagctgttcgactacatcgtcaagaacggcaagctgcaggagtcggag
gcgcgccgcttcttccagcagatcatttccggcgtcgactactgccaccggcacatgatt
gtgcatcgcgatttgaagccggaaaacttgctgctcgatcacaatcgtcacgtgaagatt
gcagatttcggactatcgaacatgatgctggatggcgagtttttgcgcacctcgtgcggc
tcgccaaactacgccgcaccggaggtaatctccggtaagctgtacgccggaccggaggtg
gacatttggtcgtgcggcgtcatactgtacgcgctgctctgcggcacgctgccgttcgat
gacgagcacgtgccgacgctgttccgcaagatcaagtcgggcgtgtttcccattccggag
tatctgaacaagcaggtggtgagcctgctgtgccagatgctgcaggtcgatccgctgaag
cgcgcgacggtggaggagatcaagaagcacgaatggttccagaaggatctgccggcgtac
ctgttcccgtcgccggtcgagcaggacagcagcgtggtggacacgaacgcgatccgcgag
gtgtgcgagaagttcagcgtgaaggagcacgaggtacacaatgcgctgctgagcggcgac
ccgcacgatcagctcgcaatcgcgtaccatctgatcatcgacaacaagcgcatcgcggac
gaggcggccaaggcggagctgaaggagttttacgtggccggcagtccgccaccgcccggt
gcggacagcaagttcggcacgccgctcggcccgggctcgatcgccccgacccaggccggc
acgccgagcgagccgttcaaatcgccctcgatacacccggaacgcattgcaccgctgcgg
gagcggccggtcacggcggcccagaacatgccggtgcccacgctcagcaccatgtcgccg
tcggccgtgatgccgatcgacaagcatcgcggcactccggtcaagcgggccaagtggcac
ctggggatacggtcgcagtcgaaaccgaacgacatcatgctggaggtgtaccgcgcgatg
aaggcgctcgactttgagtggaaaatcatcaacccgtaccatgtgcgcgtgcgcaagtac
aatgcgcgcaacgacaagcacgtgaagatgtcgctccagctgtaccaagtcgatccgaag
aactatctgctggactttaagtcgctgacgaacgacgaggtggagcagggcgacgatgtg
atcatggagagcctgacgccaccgcccccggtcgggttcggggggatgggcattccctcc
aaccatcagccgagcggccaccacacgatggagtttttcgagatgtgcggtgcgctgatt
gcgcagctggcccgctaa

DBGET integrated database retrieval system