KEGG   Anopheles gambiae (mosquito): AgaP_AGAP002711Help
Entry
AgaP_AGAP002711   CDS       T01036                                 

Definition
AGAP002711-PA
Orthology
K06091  
MAGUK p55 subfamily member 5
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:aga00001]
 Environmental Information Processing
  Signal transduction
   04391 Hippo signaling pathway -fly
    AgaP_AGAP002711
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2R
AA seq 1285 aa AA seqDB search
MQQRTTTPAAGPPPPTASSSGKQVVELNGYVIILVESRDGKIKLYGSPADKDNLEVADEI
LDVNERKLEDSPRAEVIKHIHECIQSCMIKLRVKRRSDSRLAGELGNAVQDAFVIAVEQQ
ARERLQRLSALKRITPVDMSQLSIKASISPTSHLIALNQQSQAKGGGTQDLSFLKEASPI
YVTSLASNSVTGTNTSTTVTAGVKTTFPAGANNTINNNTLNNNNNSTVGGGGVLMQNATN
NNGTTNLSSTTNTTGSSSTSGNATRLQQPGTTGMQVNVVTGQPGTGALVAVAASKGLSAL
DQPIPGNNNNGSGSTLGGGAALAGTSAYHSLHQHSLVNNNNLNSSNIGKPQGLDATANSY
YSNLTNTFLANGHGSKRELATLSEGELEPPDEPQYESSGNISRGGTEVLLGDQNLRQENR
PRRRSGSSIVVLGGDDTLKPSIPIDDYQEDLEMYNMLAANQDNGPHREMAVDVPESFIAR
NKTPPRYPPPRSTVTAASAAASTPATPASTQLNGSSKPVPPPRDHLRIEKDGRLTNRAPV
PAPQVPDRKIVPNASSQHQHIGQVLEPTPDQLDSIKKFQEQLRRRREDEERIAAQNDFLR
NSLRGSQRLRALQDNPIEKPPVGVDNEAYADDEVVAVAAEKIIGYGELVAALQRLQGHLN
KHGLAALAGRVTAAQSLLLGPGIARALAVRTAVLERRRPKIPNPICPNAQALAKDCVESL
AQSRSQTAIELCDLLSTYEMEGLLLAHDRIASTTDRSPIASYGGSPITVPVPLGTASNNT
TSNNTTTSNNSINNNTLTSAVKPATVMPSIPNNASLVNNNNNNIAKREPMSVPLGVLRDG
SQDHIKIIQIEKSSEPLGATIRNEGEAVVIGRVVRGGAAEKSGLLHEGDEILEVNGIEMR
GKSVNDVCALLGSMTGTLTFLVVPAGVPQILPGLGMRDPPVLHVRAHFDYDPEDDLYIPC
RELGISFQKGDVLHVISRDDPNWWQAYREGEEDQTLAGLIPSQSFQHQRESMKLAIAGEV
GLRTRKDINGKAGGGSTLLCARKGRKKKKKASSEHGYPLYATATADDPDPEEILTYEEVA
LYYPRASHKRPIVLIGPPNIGRHELRQRLMADSERFAAAIPHTSRAQREGEVPGQDYHFI
SRQQFESDILARKFVEHGEYEKAYYGTSLEAIRAVVASGKICVLNLHPQSLKLLRSSDLK
PYTVLVAPPSLEKLRQKRIRTGEPYKEEELKEIIATARDMEARWGHLFDMIIINNDTERA
YHQLLAEINSLEREPQWVPSSWLHN
NT seq 3858 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaaaggacgaccacgccagcagctggccccccaccaccgaccgcttcgtcgtcg
ggcaagcaagtggtcgagctcaacgggtacgtgataattctggtcgaaagccgggatggc
aaaatcaaactgtacggcagcccggccgacaaggacaacctggaggtggcggacgagata
ttggacgttaacgagcgcaaactggaggactcgccgagagccgaagttatcaagcacata
cacgagtgcatccagtcgtgcatgataaagctgcgcgtcaaacggcgaagtgattctcgt
ttagcgggcgagctgggcaatgccgtgcaggatgcgtttgtcatcgccgtcgagcagcag
gcccgggagcgccttcagcgattgtccgcgctcaagcggattacaccggtcgacatgtca
cagctttcgatcaaagcaagtatctcccctacctctcacttgatagcactcaatcagcaa
agccaggcgaagggtggcggcacgcaagatctcagcttcctgaaggaggcatcgcccatc
tacgtgacgtcactcgcgagcaacagtgttacgggtacgaacaccagcacgacggtaacg
gccggtgtgaagacgacatttccagcgggggccaacaacaccatcaacaacaacaccctc
aacaacaataataacagcacggtgggaggcggcggtgtactgatgcaaaatgcaaccaac
aacaatggcaccactaacctgtccagcaccactaacaccaccggcagcagcagcaccagc
ggcaacgcgacccggctgcagcaacccggtaccaccggaatgcaggtgaacgtggtcact
gggcagccgggaacgggcgcattggtggcggtcgcggcgtccaaagggttgtccgcgctc
gaccagcccatcccgggcaataacaacaacggcagcggcagtacactcggtggcggtgcc
gcactggccggtacgtccgcctaccacagcctgcaccagcacagtcttgtaaataacaac
aacctcaacagcagcaatatcggcaaaccccaagggcttgacgcaaccgccaacagttac
tatagtaatctaactaacaccttcctagcgaacggtcatggttccaagcgagagctggct
acactgtccgagggagagctcgagccgccggacgaaccgcagtacgagtcgagcggtaac
atatcgcgcggtggtaccgaagtgctgctgggagatcagaaccttcgccaggagaatcgg
cctcgcagacgcagcggctccagcatcgtggtgctgggcggtgatgacaccctgaagccc
tccatacctattgatgactatcaggaggacttggaaatgtacaatatgttagcggcaaac
caggataatggaccacaccgggaaatggctgtcgatgtacctgaatcgttcatagccaga
aacaaaacgcctccgcgctacccaccgccacgcagcacggtgacggcggcgtcggcggcg
gccagcacaccggcaacacccgcgtccacccagctcaatggctcgtcgaaaccggtgcca
ccgccccgggatcatctgcggatagagaaggacggccggctcaccaatcgcgcaccagta
cccgctccacaagtgccagatcgtaagattgtgccgaacgcatcatcacagcaccagcat
atcggccaggtcctggaaccgaccccggatcagttagatagcattaagaagttccaggag
caactgcgacggcgaagggaggacgaggagcggatagcggcccagaatgacttcctgcgg
aacagtttgcgcggctcgcagcggctccgcgcgctgcaggacaacccgatcgagaagccg
ccggtcggcgtcgacaacgaggcgtacgcggacgatgaggtggtggcggtggcagcggag
aagattatcgggtacggcgagctggtggcggcactgcagcgactccaggggcacctcaac
aagcacggcctggcggcactcgctggcagggtgacggcagcccagagcctgctgctcggt
ccgggcatcgcgcgggccctggccgtccggacggcggtcctcgagcggcggcgcccgaag
ataccgaaccccatctgccccaatgctcaagcgctagcaaaggattgcgtcgaatcgctg
gcccagtcccgctcgcaaaccgcgatcgagctgtgcgatctgctgtccacgtacgagatg
gagggtctgctgctggcgcacgatcggatcgcctcgaccacggaccgttcgccgatcgct
tcgtacggtggcagcccgatcaccgtcccggtgccgctcggcacggccagcaacaacacc
accagcaacaacaccaccaccagcaacaacagcatcaacaataacaccttgaccagtgcg
gtgaaaccggccactgtcatgccatcaattccaaataacgctagtttagtgaacaataac
aataacaacatcgctaagagggaaccaatgagtgtaccgctcggggtgctgcgcgacggc
agccaggaccacatcaagatcatccagatcgaaaagtcgtccgagccgctcggtgccacc
atccggaacgagggcgaagcggtcgtgatcgggcgggtcgtacggggcggtgcggccgaa
aagtccggcctgctgcacgagggcgacgaaatactggaggtaaacgggatcgaaatgcgc
ggcaagtcggtgaacgatgtgtgcgccctgctcggctcgatgaccggcacgctcacgttt
ctggtcgtgccggcgggcgtaccgcagatactgcccgggctcggtatgcgcgatccgccc
gtgctgcacgtgcgggcccacttcgactacgatccggaggacgacctgtacataccgtgc
cgggagctgggcatcagcttccagaagggtgacgtgctgcacgtgatctcgcgcgacgat
ccgaactggtggcaggcgtaccgggagggcgaagaggatcaaacgctcgccgggctgata
ccgagccagtcgttccagcatcagcgcgaatcgatgaagctggcgatcgcgggcgaggtg
gggctgcgcacgcgcaaagacatcaacgggaaggcgggcggcggctcgaccctgctgtgc
gcccgcaagggacggaagaagaagaagaaggccagcagcgagcatgggtacccgctgtac
gcgaccgccaccgcggacgatcccgacccggaggagatactcacgtacgaggaggtggca
ctgtactacccgcgtgcctcccacaagcgaccgatcgtgctgatcgggccgccgaacatt
gggcggcacgagctgcgccagcggttgatggcggattcggagcgctttgccgcggccatt
cctcatacgtcacgagctcagcgggagggcgaagtgccgggccaggactatcacttcatc
tcgcggcaacagttcgagtcggacatcctggcccgcaagtttgtcgagcacggtgaatac
gagaaagcgtactatggcacatcgctggaagcgatccgagcggtggtcgctagcggcaag
atatgtgtgctgaatctgcacccccagagccttaagctgctgcgctcgtccgatctgaag
ccatacaccgtgctggtggcaccgcccagcctggaaaagctgcgccaaaagcggatacga
accggtgaaccttacaaggaagaagaactgaaggaaatcattgccaccgcacgcgacatg
gaggcacgctggggccatctgttcgatatgatcatcatcaacaatgataccgagcgggcg
taccatcagctgctggccgagatcaattcgctcgagcgggaaccgcagtgggtcccgagc
agctggctgcacaactag

  All links  
No link information was found.   
DBGET integrated database retrieval system