KEGG   Anopheles gambiae (mosquito): AgaP_AGAP002741Help
Entry
AgaP_AGAP002741   CDS       T01036                                 

Definition
AGAP002741-PA
Orthology
K09186  
histone-lysine N-methyltransferase MLL1 [EC:2.1.1.43]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:aga00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    AgaP_AGAP002741
Enzymes [BR:aga01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     AgaP_AGAP002741
Transcription factors [BR:aga03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    AgaP_AGAP002741
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2R
AA seq 4925 aa AA seqDB search
MGKSKFPGKPSRLVNKKRVSVLSPAGLTLSDEDNQENHGREQQQQQVQSGVGSATGSVLT
ASSNTHRTSSPASSGSSAATVSMRSSSSSSSGSGSEKHSAFGQRKEQQQHSSVSGAGPKA
TKGGTVTSNGGSSGTVTAGSGQSSATAENGSGRRNGTDKQTAGAAAASKDGGASKNNETE
SGGDDNDDHNNNGENEDAEEEEEDDDEEDDDDEDDDEEDYDDEEDDEEEEEEEEDEEDDE
DEEQDGEGRKMPPPLGAVGTAGDESTATSSSSSSSSTAGTAAAATTTSATSGSSTAASIA
SSSGPISGTSEVRSVVGNGQQQSSSQQQPTMQSSSSSARSEKLPATGNGFEMKPSTLTSA
LARRCPPGVASGRVSRQQSPASCDQTLNTSTSSESSNTSSSSSSSSSSSLSPTIGSTASL
GRSQKAEVSSSAEQQGAAIADGSTDSSQATAATLMVGAKLPTSASAAQSPPGTVAAAPPV
KKKSVTFHTTLETTDENIVRKVYNPDTVPLPSIIKKECLARPIRLKKSFNRKMKKRLQRA
VAAAAAAAAASAAASASAGASGASKAMECLVRPSRLTEIVQKSSSGGKPAASGAALVSSL
DSKTGCGSVGGLGFGLKVAEGPKPGGVCSFGALVEPAPLVSPAAAAAATTTTTVATEGGE
LTSNRNLESGGTQFGDKRFILPKRSVHSSRVIKPNKRFLDEFELEIKKKNKNLAAAAAIA
AAAAAAGTGSALGCGAAGMAPNSSSTTAAGLGALGKPAGGELAAAAGDGNEGDGVAGDDT
RRRKDKKKLDELTAGSSDKLLATGMFCIDFFNEEFDNNPFFINLLCTAHHHSPEGSPAGD
RPLMTPISINPFAKTSLSDGTLAGAGTKSAGSKLMKPSQLSPAIGPGSVLGAAGSATTTT
TNLAAAASIFGKGILRQPRLQFATSLLNSAGHSIGGMNGAAAAAATLNSITSSNSHALHA
VPSGTNNSVVTASAAASATLGSSNGATEGLFTMHLKAKAKLDSSKLFSAALGVGAAAGVA
GQPGTGGSAGAAPCCICGIPVNSRHYAQPTKKYGVSCCDVCRKFISKMVKKLATGSLIGP
GQPAGGADVTMLKCKNEGKCLIVPPSQLMRPEAVKTRHIFKERCHACWLRKCLGSFQLPP
VLKIRLGQTLPLTMRTFEPPASGTPAGCPITLKKDPSTEGNLFANSIAEHGPANGGTAGR
ILWNSGDRKPGTLTDGFSKAFNPFMALHINPLSQNNSTFGSVPQIKLSLGGGERSGLMAA
SPSSSSGASSSGAKSPLSGKEDIFAPIEPRKEKDGVKVEDTKSVLAADGVAAGARKDIKE
EQEISPIKAPRTRSKSEATGTDAATAATATAALETKAEASTASSVAANGSTQQPTAAGGS
AAAGSQPATGPNKGAASDRQRIDLKGPRVKHVCRSASIVLGQPLATFADDGSVGSPSGGA
LENIETPPSDSAAEPAEDLPLMDRERRATKTAVPSGVKPQDCNDCIDPGVALSPPATPDD
DAETVRGTPTKSDRFDPDTSGSTEKELVIDEDKLPDGAEAKEEQLADAESIVSDLKAQIG
ESVANTIVATEAMPAKEDQMMKPLAVAIPAAPVAKRYDESVEKPTTRKTTSSFRPQASKQ
FGVGAIAKGPSNISGRKQQQSQGSSALVALGGRNAAASMGVGANGGLGAGSNLRTPSDVP
MISIDFWENYDPAEVSRTGFGLILSESMPVRALCFLCGSAGLESMLFCVCCCEPYHQYCV
KDEYNLRTGTGTGLDDTGNMSLLDVTLGASPQQQQEQLLIARYNWMCPRCTVCFSCNMAT
GAKVKCQKCAKHYHTTCLGTSKRLHGADRPLICAACLRCKSCGTTNVTKFIGNLPMCTPC
FRLRQKGNYCPLCQKCYEDNDFDLKMMECGDCRRWVHARCEGLTDEQYNMLSVLPENIEF
VCKKCAKHSSDSTAHLWRDAVAAEFKAGLLSVVKLLSKSRQACALLKLSPRKKSPNCTCG
AAAGSITNGKQISFFTAGPLGEGGFSASKKPKLDEDSIYDFSSENSCGSSSGNSNTGAGY
AVVPVAGSKCYCAGRQAMPGKGSPNGGDISLVDIKQKINANEYYSLQDFHYDMNLLLQVV
GSEELTVAYKEFLSETFPWFQNETKACTDALEEAMRGEVDQANGLDQYHHSSAGVGGMGG
RVGGHTGAAHLAGGAYEAFGPALDQKVPQIDIPLDELTDYFHDTEEELLDTRMCMLCKQH
GEGMPLHESRLLYCGQNNWVHTNCALWSAEVFEEIDGSLQNVHSAASRGRMIKCCHCGVK
GATVGCNVKNCGEHYHFPCARRIGCVFMLDKTVYCAAHAGEAKKKRCPEERHFEIARSVY
VELDRRKKRFVEPARVQFMIGSLNVRRLGHVVPTFSDHADVLIPTDFECTRLYWSAKEPW
KIVSYRIKTSIQCNNYGYGTDLGKNFTVDHSSHSSTVQWGLTQIARWHTSLQYSDGQDEA
EFEAQEESEALQQHLLSSMSSTATTMTTTTATTQLRSCDRGSSVKQQQQQQQQLQSLCES
NPGVCGDDTNDEEPQNTNDLLPPEIKDAIFEDLPHDILDGISMLDILPKLMTYEDLLAMD
LKTDATFNVDILKDPNGLLQVHSNVAGSSSSSSGAAASNALGQPSKPEDHAGMDVDDMVS
LQEAIGGAVGSELSNDSWAKTIGTPGIEDALLSSMTKPNATSNGASASGPGQQQQQHREL
KRSKSDLLEAIAAVGSHQQPRGQRSGSFSWSTKQLESTAAVVAKRRKIGKNNIKLSDVLS
LGRIKEDAAFGGTLSTTTTTTTTTATLATATTTTTTVVMQQERRKSQDEYSWAAMKKSTT
VLESASSAESGHVFQKLKISQLDGVDDICLDGTMGEMKIYSSRSMIEAPVKCDRCQATYR
NQESYQRHLSSCEVLSTSESESETRSPRLLSPEQQQQQQQQQQQQQQQIITGQIAGTAGN
TFLLPQATTQPQTITTDIYGNTTGYLTGTAQGAGHPQTISVLQTGQTINLGNGNQAILSN
LPTSMPITINQLSSNGIPIQTSAAGAQQIPLQGTVGLQNLAGNMIISGPNGQGQLFATTN
QFPNATFQQQSQPQQQQLLQDNGSQQYVQSKQRFIQPAPTASPITLPHSLASGAGPMSTT
TLSTAQPLGSVFAQQPQIISIGPNGQPQLMTLAAPQQQQQQTILQTGGAQQLTMQPTAKK
IVYTTASPKKMMSKLGQQGALKTKRAMASNGVAKSAMQMKAKQQQQQQQHQQQQHQQHHL
HQPQEQTMTLHPTLLGGQTIATPQQQQQQQQQQQQQIQLINASYPLIRSGNAPQQAPGNI
IFQTQPSANQPILVQQVGGNQISYLSDQGTLTHSPVQYQLAPANVLTQNGFAMATAGTDA
GTLAAAANNILIPNGTGGYSLIPASALQIATQPQVIGTIVQPQAATLQCGMMAAEQMVLG
APGGATATAQPTLEMMVTDPASGCMYLTSPSMYYGLETIVQNTVQMSSQQFVSATAMQGV
LSQNSSFSATTTQVFAASKIEPIVEMPAGYVVLNNDGTAQPMQIGTTSTASVVSQAPVQI
QTSTSANGGQPIFQQAQAPLQPTTVVSSMAGTLPSTMQTSHQPMGTIQQQQQQQQQQQQQ
MWKIDVSSPSAMSIQQSTNTIASSSSTGATTSIVTPLKPSMKTIVPKAQPQLVNKVMPNT
AMKVLSSSTEQITTSSGAVSTSQQHKSSAAAYQSIVSSSVYTTATAMTTSTKVSNVIKPI
TKTTNYTKPKIVAKPVKQKSSSTASSLLSPPPSTPPPTSMFQLTPQNQQQQQQAPQSLMI
TTQPVAQQQQQQLLQNSITLIPAGNAIASVVNNSSQLVPIKPNVGVNGLPTITANQLTVS
AIKQQPSMVIEKLAQPPVASPTAPAPSGGPMMIIQPTSAAHKKPQHGNTQGAMKKQKTML
PTQMISYATPQQQAQSGQQQPYQQVMSVSTGSQQQLAGLAQQQQQQQLQAQPITITQGKG
SLAKKSASAGQITLSIANTGPNGGSGPVPVSMPASTITITPSPPASITLPTAPYPMPLYS
NIPTNVVNPIQQQTNSQGSGAGATIASGGNTVQNRPTNRVLPMQASVLQQKAPEVSQTPP
PPPLKLLQQQCSEKLDEFSIMPSNHPAQSPYGVSTPSASPNDVDRMKLAGQEEKLLPSAG
KPNSRLEIEIKPIEIAPLPSALMTPTTTNGSCTPSPLPPAMQQQQQQDSSPMVSLAQAEE
QANSMLMEMEEQTEQLQQQQQQDHLQQSHEPLTPSFQFSLSFDGNGTLIPLGGGPLDPQQ
PTMAAQIEIKPILPPTADGLQSPQQQTTTLMSHDSLEDAERRDTEETQRIDELKHSLEAE
TQEMLAEGHEASLCGDSGAGGSGGAASPSLNDGESDSPEIKHKISEILDNLEQQTSQEGE
QLQMDAFESLRQSKELQQEHHHHHHHHHRAIETDAECAAETERLVAELREEFQSSAASSP
SLATTATTVPLMTVVEQQSNETGAAGGPLADQQSLLAISSSMFEPKMKPDEAGCFRDVVE
RSSFGGCGPAAHDFDSVALLHGGDAESVLFGKIRQPEPSPMSQPSPTEHHHQQMQLDEEL
QQYTSVQQLPPQPSVQTAAAAPKPQAVPRPTSPKLLYEIQSQDGFTYKSTSIAEIWDKLF
EAVQLARRAHGLAALPDGQLKEMAGVQMLGLKTNAIRYLLEQLPGVEKCSQYSPLYHKKQ
TGGIAGGPYGAGGAGAGVNGLGANGGASEYADYFEDLQENPHGTARCEPYGTRSEYDMFS
WLASRHRKQPMPIVAQNIDDTIIPRRGSGSNLPMAMRYRTLKESSKESVGVYRSHIHGRG
LFCNRDIEAGEMVIEYAGELIRSTLTDKRERYYDSRGIGCYMFKIDENFVVDATMRGNAA
RFINHSCEPNCYSKVVDILGHKHIIIFALRRIVQGEELTYDYKFPFEDVKIPCSCGSKKC
RKYLN
NT seq 14778 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagtccaagtttcccggcaaaccgtcgcgtttggtgaacaagaagcgcgtctcg
gtcctgtcgccggccgggctcacgttgagcgatgaggacaatcaggagaaccacggccgg
gagcagcagcagcagcaggtccagtcgggagttgggagtgccacggggtcagtcctgact
gccagcagcaacacgcaccgcacgtcgtcgcctgcctcgtccgggtcgtccgcagcaacg
gtttcgatgcggtccagcagcagcagcagcagcggcagcggcagcgagaagcattccgcg
ttcggacagcgcaaagagcagcaacaacattcgtccgtgtccggtgccggcccgaaggca
actaaaggaggcacagtgacgagcaacgggggcagcagtggtacagtgacagccgggtcc
ggccagtcctcggcgaccgcggagaatggaagcggacgaaggaacggcacggacaaacag
acggccggagcagcagcagcatcaaaggatggtggcgccagcaagaacaatgaaaccgaa
agcggtggcgatgataacgatgaccacaacaataatggcgaaaacgaggacgccgaagag
gaggaggaagacgacgacgaagaggacgacgacgacgaggacgatgatgaggaggattac
gacgatgaagaggacgacgaggaggaggaggaagaggaggaggatgaggaggacgacgaa
gacgaggagcaggatggtgaagggcgaaagatgccgccgccgctcggtgcagtaggcacg
gcgggggacgagtcaaccgcaacgagcagcagcagcagcagcagcagtactgcagggaca
gctgccgccgccaccaccaccagtgccaccagcggctcgtccactgcagcatcgatcgct
tccagttcgggccccattagcggcacgagtgaggttaggtcagtcgtcggcaacggccaa
cagcagtcgtcatcgcagcagcaaccgacgatgcaaagcagcagtagcagcgcccgaagc
gagaagctgccagcgaccggaaatggtttcgaaatgaaaccatccaccctgacgtcggcg
ctggcccgccggtgcccgcccggtgtggcatccggtcgagtcagccggcagcagtcgcca
gcgtcctgcgaccaaacgctcaacacaagcaccagtagcgaaagcagcaacactagcagt
agcagtagcagcagcagcagcagcagtctaagtcccaccatcggcagtactgcgtcgttg
ggtcgctcgcagaaggcggaagtatcgtcgtcggccgagcagcagggagcagcgatagcc
gacggaagcaccgactcctcgcaggcaaccgccgcgacactaatggttggcgcgaagcta
ccaacgagcgcttccgccgcccagtcgccaccgggcacggtcgcagcagcaccaccggtg
aagaagaaaagtgtcacgtttcacaccacgctcgagacgacggacgagaacatcgtgcgg
aaggtgtacaacccggacacggttccgctgccatcgatcatcaagaaggagtgtctcgcc
cggccgatccggctgaagaagagcttcaaccggaagatgaagaagcgactgcagcgggcg
gtggcggcggcggccgctgccgcagcggccagtgcggccgcctccgcgtcggccggcgcg
tccggtgcgagcaaagcgatggaatgtctggtgcgcccgtcccggctgacggagatcgtg
caaaagtcgtcgtcgggcggcaagccagctgcatccggtgctgcgttggtgagctcactg
gatagcaagaccggctgcggctcggtcggtggccttggctttgggctgaaggtggccgag
gggccgaaaccgggtggcgtttgctccttcggagcgttggttgaaccggcaccactggta
tcgccagcagcagcagcagcggcgacgacgacgacgacggtggccacagaagggggcgaa
ctgacgagcaaccgtaacctcgaaagcggaggcacccagttcggtgacaagcggttcatt
ctgccgaagcggagcgttcattctagtcgtgtgataaagccgaacaagcggtttctggac
gagtttgagttggagattaagaagaagaacaaaaacctggctgcggcggctgccattgcg
gctgcagctgcggccgccggtacgggttccgctttgggctgcggtgccgctggaatggcc
ccgaactcctcctccaccacggcagccggtctgggagcgttgggcaaaccggccggcgga
gagctggcagctgctgctggagacggaaacgaaggcgacggtgtggccggagacgataca
aggcgaaggaaggacaagaagaagctcgatgaattgacggcaggatcgtccgacaaactt
ttagctacaggtatgttttgtattgatttttttaatgaggaatttgataataacccattt
tttatcaatttactttgcacagcgcatcatcacagcccggagggaagcccggccggcgac
cgtccacttatgacgcccatcagtattaacccattcgcgaagacatcactctcggacggt
acgcttgcgggcgcgggcacgaaaagcgccggctcgaagctcatgaaaccatcgcaactt
tcgccggcgatcgggcccggctcggtgctcggtgcggccggcagcgccaccaccacgacc
acgaatctcgcggcggccgcctccatcttcggcaagggcatcctgcgccagccacggttg
cagtttgccacatcgctgctcaacagcgccggtcacagcatcggaggcatgaatggtgcc
gccgcggccgccgccaccctaaacagtattacttcctccaattcccacgctcttcacgct
gtgccgtcgggcacgaacaactcggtggtgacggcatcagcagcagcatcggcaaccctc
ggatcaagcaacggcgcgaccgaaggattgtttacaatgcatctgaaagcgaaggcaaag
ctcgactcctcgaagctgttctcggcggcgctcggtgttggcgcggccgccggtgttgcc
ggccagccgggtacgggcggctccgccggtgcggcaccctgctgcatctgcggcatcccg
gtgaactcgcgccactacgcgcagccgacgaagaagtacggcgtcagctgctgcgacgtg
tgtcgcaagttcatctcgaagatggtgaaaaagctggccaccgggagcctgatcggtccg
gggcagccggccggtggggcggacgttacaatgctcaagtgcaaaaacgagggcaagtgt
ctgatcgtcccaccgtcgcagctgatgcggccggaggcagtgaaaacgcgccacatcttc
aaggagcggtgccacgcgtgctggctgcgcaagtgtctcggcagcttccagctaccgccc
gtgctgaagatccggctgggccagacgctgccgctgacgatgcgcacgttcgagccgccg
gccagcggaacgccggccggctgcccgatcacgctcaaaaaggatccgtcgacggagggc
aacctgttcgcgaacagcatcgccgagcacgggccagcgaacggtgggaccgccgggcgc
atcctgtggaacagtggcgaccggaagccgggcacgctgacggacggtttcagcaaagcg
ttcaatcccttcatggcgctgcacatcaatccgctgtcgcagaacaacagcacgtttggc
agcgtgccgcagatcaagctgtcgcttgggggaggcgaacggagcggcctgatggcggcg
agcccgagcagttcgtccggcgccagctcgtccggcgccaagagtccgctgtccggcaag
gaggacatcttcgcgccgatcgaaccgaggaaggagaaggacggcgttaaggttgaggat
actaaatcggtgctggcggcagacggtgttgctgccggcgctcgaaaggacatcaaggag
gagcaggagatcagccccattaaggcaccgcgcacgcgcagcaaatccgaagcgaccggc
acggacgcagcaacagcagccacggcaacagcagcgctcgaaacgaaggcggaagcatcc
accgcttcctcagtggctgccaacggctcgacgcaacagcctacggctgccggtggcagt
gctgctgccggttcgcaaccggcgaccggcccgaacaagggtgccgcgtccgaccggcag
cgcatcgatctgaagggcccgcgggtgaagcacgtgtgccgcagcgcgtcgatcgtgctc
ggccaaccgctggccacgttcgccgacgatggttcggtcgggtcgcccagcggtggtgcg
ctggaaaacatcgaaacaccgccgagcgatagtgcggccgaaccggccgaagatctgccg
ctgatggaccgggaacgacgggccacgaagacggcggtgccgtcgggcgtcaagccccag
gattgcaacgattgtatcgatccgggcgtagcgctgtcgccgcccgcgacaccggacgat
gatgcggagacagtgcgaggcacaccgaccaagagcgatcgattcgatccggacacgagc
ggatcgacggagaaggagctggtgatcgacgaagacaagctgccggatggggccgaggca
aaggaagaacagcttgccgatgctgaatcgattgttagtgatttgaaggcgcaaattggc
gagagtgttgccaataccatcgtggcgacggaagcgatgcccgcaaaggaggatcaaatg
atgaaaccacttgccgtggcaattcctgccgcaccggtggcaaagcggtacgacgagagt
gtggaaaagccgaccacacgcaagacgaccagctcattccgcccgcaagcctcgaagcag
ttcggcgtcggtgcaatcgcgaaaggtccctcgaacatcagcggccggaagcagcaacaa
tcccaaggctcctccgcactggtcgcccttggcgggcgcaatgcagccgcctcgatgggc
gtcggagcgaacggcggcctgggggctggctcaaacctacgcaccccgagcgatgtgccg
atgatttcgatcgacttctgggaaaactacgacccggccgaggttagccgcaccgggttc
gggctgatactgtccgagtcgatgccggtccgtgcgctctgctttctctgcggcagtgcc
gggctggagagtatgctgttctgcgtgtgctgctgcgaaccgtaccatcagtactgcgtg
aaggacgagtacaatttgcgcaccggcacgggcacgggcctggacgataccggcaacatg
agcctgctggacgtgacgctcggtgcgtcaccccagcagcagcaggagcagctgctgatc
gcacgctacaactggatgtgccctcggtgcacggtgtgcttcagctgcaacatggcgacg
ggcgcgaaggtaaagtgtcagaagtgcgccaagcactatcacaccacctgtctcgggacg
agcaagcggctgcacggtgccgaccggcccctgatttgtgctgcctgtctgcgctgcaag
agctgcggcaccacgaacgtgacgaagtttatcggcaacctgccgatgtgtacgccctgt
ttccggttgcgccagaagggcaactactgcccgctctgccagaagtgctacgaggacaac
gatttcgacctgaagatgatggagtgcggtgactgccgccggtgggtgcacgcgcgctgc
gagggactgacggacgagcagtacaacatgctgagcgtgctgccggagaacattgagttt
gtgtgcaagaagtgcgcgaagcacagcagcgacagcacggcccacctgtggcgtgatgcg
gtcgcggctgagtttaaggccggtctgctgagcgtcgtgaagctgctgagcaaaagccgc
caggcgtgtgcgctgctgaagctgagcccgcgcaaaaagtcgcccaactgtacgtgcggt
gctgcggccggttcgatcacgaacgggaagcagatttcgttcttcaccgctgggccgctt
ggagagggcggattttccgcctcgaagaagccgaagctggacgaagactccatctacgat
tttagcagcgagaacagctgtggaagcagcagcgggaacagcaacaccggcgctggctac
gccgtggtgccggtggcgggcagtaagtgctactgcgctgggcgtcaagcaatgccgggc
aagggttcgccgaacgggggcgacatcagtctggtcgacatcaagcaaaagatcaacgcc
aacgagtactactcgctgcaggatttccactacgacatgaacctgctgctgcaggtcgtc
ggctcggaggagctaacggtggcgtacaaggagttcctgagcgaaacgttcccgtggttc
cagaacgaaacgaaggcgtgcaccgatgcgctcgaggaggcgatgcgcggcgaggtggat
caagcgaacgggctggatcagtaccaccactcgtcggccggggtcggcggaatgggtggt
cgggtcggtgggcacactggtgcagcccatctggctggcggtgcgtacgaagcgttcgga
cccgcgctcgaccagaaagtgccgcagatcgacatcccgctggacgagctgacggattac
ttccacgacacggaggaagagctgctcgacacgcggatgtgcatgctgtgcaagcagcac
ggcgaagggatgccgctgcacgaatcgcgcctgctgtactgtggccagaacaactgggtg
cacaccaactgtgcgctctggtcggcggaggtgttcgaggagatcgacggctcgctgcag
aacgtgcattcggcggcgtcgcgcggccgcatgatcaagtgctgccactgcggcgtaaag
ggtgccaccgtcgggtgcaatgtgaagaactgtggcgagcactaccacttcccgtgcgcc
cgccgcatcgggtgcgtgttcatgctggacaaaacggtgtactgtgcggcccacgcgggc
gaggcgaagaagaagcgctgcccggaggagcgccactttgagattgcgcgctcggtgtac
gtggagctggaccggcggaagaagcggttcgtcgagccggcccgggtacagttcatgatc
ggttcgctgaacgtgcgccggctgggccacgtggtgccgacgttcagcgaccacgcggac
gtactcatcccgacggactttgagtgcacgcggctctactggtcggccaaggagccgtgg
aagatcgtatcgtaccgcatcaaaacgtcgatccagtgcaacaactacgggtacgggacc
gatctgggcaagaactttaccgtcgatcactcgtcgcacagcagtacggtgcagtggggc
ctcacacagattgcccgctggcacaccagcctgcagtacagcgatgggcaggacgaggcg
gagttcgaagcgcaggaggagagcgaagcgctgcagcagcatcttctctcgtctatgtcc
tcaacggccacgacgatgaccactacgacagccacgacgcagttacgcagttgcgaccgg
ggctcatcggtgaagcagcagcagcagcagcagcagcaactgcaatcgctctgcgagtcg
aatcccggcgtgtgcggcgacgatacgaacgacgaggagccgcaaaacacgaacgatctg
ctgccgccggaaattaaggacgcaatcttcgaggacctgccgcacgacatcctggacggc
atctcgatgctcgacatcctgcccaagctgatgacgtacgaggatctgctcgcgatggat
ctgaaaaccgatgccaccttcaacgtggacatactgaaggatccgaacgggctgctgcag
gtgcacagcaatgtggctggctcgtcctcgtcctcgtccggtgctgctgcgtcgaacgct
ctcgggcagccttccaagccggaggatcatgccggcatggatgtggacgatatggttagc
ctgcaggaagcgattggcggtgccgtcggatcggagctgagcaacgacagctgggcgaaa
acgatcggcacacccggcatcgaggacgccctgctgtccagcatgacgaagccgaacgcc
accagcaacggtgcgtcagcaagcggacccggacagcagcagcagcagcatcgggagctg
aagcgtagcaaatcggacctgctggaagcgatcgcagcggtcggtagccatcagcagccg
cgcggccaacggtcgggcagcttctcctggagcaccaagcagctcgaatcgacggcggcc
gtcgtggcgaagcgtcgcaagatcggtaaaaacaacatcaaactgtcggacgtactttcg
ctgggaagaatcaaggaggatgcggcctttggcggcacgctgtcaacgacgaccacgacc
accacgacgacggccacactggcgactgcaacgaccaccaccaccaccgtcgtgatgcag
caggagcggcgcaaatcgcaggacgaatactcctgggccgcgatgaaaaagtcaacgacc
gtgctggaaagcgcgtcgtcagcggagagtggccacgtgttccagaagctgaaaatatcc
cagctggacggtgtggacgacatctgtctcgatgggacgatgggcgagatgaagatttac
tcgtcgcgctcgatgatcgaggcaccggtcaagtgtgaccgctgccaggcgacgtaccgc
aaccaggaatcgtaccagcgccatctcagctcgtgcgaagtgctctcgaccagcgaatcc
gagtcggaaactcgatcgcctcgcctgctgagtcccgaacagcaacaacaacagcaacaa
caacagcaacagcaacagcagcaaattatcaccggccagattgcgggcactgccggcaat
actttccttttgccgcaggccacaactcaaccgcaaacgatcacaaccgacatttacggc
aatacgacgggctatctgaccgggacggcgcaaggtgccggccatccgcaaaccatctcc
gtgctgcagaccggacaaacgatcaatctcggcaacggcaatcaggcgatactgtccaac
ctgcccacctcgatgccgatcacgatcaaccagctgtcgtcgaacggcatcccgatccaa
acgtcagcggccggggcgcagcaaatcccgctccagggcacggttgggttgcagaatctg
gccggcaacatgatcatctccggcccgaacggtcaagggcaactgttcgccaccacgaac
cagttccccaacgccaccttccagcagcagtcgcagccgcagcaacagcagctcctgcag
gacaacgggtcgcagcagtacgtgcagagcaagcagcgattcattcagccagctccgacc
gcttcgccgatcacgttgccccacagccttgcgtctggcgcgggccctatgtcaaccacg
acgctcagcaccgctcaaccgctcggcagtgtgttcgcccagcagccgcagatcatctcg
atcggaccgaacgggcagccgcagctgatgacgctcgccgctccacagcagcagcagcag
caaacgatcctgcagacgggcggcgctcagcagctgacaatgcagccgacagcgaagaag
attgtctacactaccgcctcgccgaagaagatgatgagtaagctgggccagcaaggcgca
ctgaaaacgaaacgtgcgatggcatcaaacggtgtggccaagtcggcgatgcagatgaag
gccaaacagcaacagcagcagcagcagcaccaacagcagcagcaccaacagcaccatctc
catcaaccgcaagagcaaacgatgacgctacatcccaccttgctcggtggccagacgatt
gctacacctcagcagcagcagcaacagcaacagcagcaacaacagcaaatccagctgatc
aacgcatcctacccgctgatccgatcgggaaacgcaccacagcaagcgccgggaaacatc
atcttccagacccagccgtccgccaaccagcccatcctggtgcagcaggtcggcggcaat
cagatctcgtacctctccgaccagggcacgctcacgcacagcccggtccagtaccagctg
gccccggcgaacgtgctcacgcagaacgggttcgccatggccacggccggtacggatgcg
ggcacgctcgccgccgccgccaacaacattctcatcccgaacggtaccggcggctactcg
ctcatcccggcgagcgcgctgcagatcgccacccagccgcaggtaattggcacgatcgtg
caaccccaagcagctaccctccagtgcggcatgatggcggcggagcagatggtgctgggt
gcgccgggcggtgcgaccgccaccgcccagccgacgctcgagatgatggtgaccgatccg
gcgtcgggctgcatgtacctgaccagcccctcgatgtactacggcctggagacgatcgtg
cagaacacggtgcagatgtcctcgcagcagttcgtgtccgccacggcgatgcaaggtgtg
ttgagtcagaattcaagcttttccgctactacgacgcaagtgtttgcggctagcaagatt
gaaccgattgtcgaaatgcccgcagggtacgtggtgctgaacaacgacggcaccgcccag
ccgatgcagataggaacgacgtcgacggcgtccgtcgtgtcgcaggccccggtccagatc
cagacgtccaccagcgcgaacggagggcagccgatcttccagcaggcgcaggctccactc
caaccgaccacagtagtatcgtcgatggccggcacgctccccagcacgatgcagacgagc
caccagccgatgggaacgatccagcagcagcagcagcagcagcagcaacagcagcagcaa
atgtggaagatcgatgtgtcctccccgtcggcaatgagtattcaacagagtacaaacaca
attgccagcagcagctcgaccggcgccactacctcgatcgtaacgccgctgaaaccgtcg
atgaaaacgatcgtgcccaaggctcagccgcagctcgtcaacaaggtcatgccgaacacg
gccatgaaggtgctgagcagcagcacggagcagatcactaccagcagcggcgcggtgtcg
acatcccagcagcacaaatcgtccgctgccgcgtaccagtcgatcgtctcgtcgtcggtc
tacacgacggccaccgccatgaccacctccaccaaggtttcgaacgtgatcaaaccgatc
accaagacgaccaactacaccaaaccgaagatcgtggccaagccggtcaagcagaagagc
tcgtccacggcctcatcgctgctttcgccgccaccatcgacgccgccaccgacctcaatg
ttccagctgaccccacaaaatcagcagcagcagcaacaggcgccccaatcactgatgatc
acgacgcaaccagtggcgcagcagcagcagcaacagctactacagaacagcatcaccctg
ataccggccggcaatgctatcgcctcggtagtgaacaactcatcccagctggtaccgatc
aagccgaacgtgggcgtgaacgggctgccgaccatcaccgccaaccagctcaccgtgagc
gcgatcaagcagcagccgtcgatggtgatcgagaagctggcgcaaccgccggtagcatcg
cccacagcgccagcaccgagcggcggtccgatgatgattattcagcccacaagcgcagcg
cacaagaagccacagcacggcaacacgcagggcgctatgaaaaagcagaaaaccatgctg
ccgacgcagatgatcagctacgcgacgccccaacagcaagcccagtcgggccagcagcaa
ccgtaccagcaggtaatgagcgtgtccaccggcagccagcagcaactggccggacttgcc
cagcagcaacagcagcagcagctgcaagctcaacccatcaccatcacgcagggtaaaggg
tcgctggcgaaaaagtccgccagtgcagggcagatcacgctgtcgattgccaacaccggc
ccgaacggtggcagcggcccagtgccggtttcgatgccggcctccaccatcacgatcacg
ccctcgccgccggccagcataacgctgccaaccgcaccgtacccgatgccgctctactcc
aacattcccaccaacgtggtgaacccgatacagcagcagacgaacagtcagggcagcggc
gccggcgcgacgatcgcgtccggcggcaacacggtgcaaaaccggcccaccaatcgcgtc
ctgccgatgcaggcctccgtactgcagcagaaagcgccggaagtgtcgcaaacgccgcca
ccgccacccctgaagctgctgcagcagcagtgctcggagaagctggacgagttttccatc
atgcccagcaaccatccggcgcagtcgccgtacggtgtgtcgacgccgagcgcctccccg
aacgatgtggaccggatgaagctggcgggccaggaggagaagctgctgccgtcggccggc
aaaccgaacagccggctcgagatcgagatcaagccgatcgaaattgcgccgctcccgtcg
gcactgatgacgccgaccacgacgaacggtagttgtacaccttcgccgctgccgccagcc
atgcagcagcagcagcaacaggactcctcgccgatggtatcgctagcgcaagcggaagag
caggcgaacagtatgctcatggagatggaagagcagacggagcagctacagcagcagcag
cagcaggaccatctccagcagtcgcacgaaccactgacaccgagcttccagttcagtctc
agcttcgatggcaacggtacgctgatcccgctcggcggtggaccgctcgatccgcagcag
cccaccatggcggcgcagatcgaaatcaagccgattctcccgccgacggccgacgggctg
caatccccgcagcagcaaacgacgacgctgatgtcgcacgattcgctcgaggacgcggag
cggcgggacacggaggaaacgcaacgcatcgacgagctgaagcattcgctcgaggcggaa
acgcaggagatgctggccgagggccacgaagcgtcgctgtgcggggacagtggggccggc
ggtagcggtggcgcggcgtcaccgtccctgaacgacggtgagtccgattcgcccgagatc
aagcataagatttcggaaattctggacaatctcgagcagcagacgagccaggaaggggag
cagctgcagatggacgcgttcgagagcctgcggcaatcgaaggagctacagcaggaacat
caccatcatcatcatcatcatcaccgtgcaatcgaaacggatgcggagtgtgcggccgaa
acggagcggctggtggcggagctgcgggaagagttccagagttcggcggcgtcctcgcca
tcgctagcaacgaccgccacgaccgtaccgctgatgacggtcgtcgagcagcaatcgaac
gaaactggtgccgccggcggtccgcttgccgatcagcaatcgctgcttgccatctcgagc
agcatgttcgagccgaagatgaagccggatgaggccggctgcttccgggacgtggtggag
cggtcgagctttggcgggtgcgggccggcggcgcacgatttcgacagcgtcgcgctgctg
cacggtggcgatgcggagagcgtgctgttcggtaagatccggcagccggaaccgtcgccg
atgtcgcaaccgtcgccgaccgagcaccaccaccagcagatgcagctggacgaggagctg
cagcagtacacctcagtgcagcagctaccaccccaaccgtcggtgcaaacggcagcagcc
gcaccgaagccacaggcagtgccgcgcccaaccagtccgaagctgctgtacgagatacag
tcgcaggacgggttcacgtacaagtcgacctcgatcgcagaaatctgggacaagctgttc
gaggcggtacagctcgcacggcgtgcccacggccttgccgcactgccggacggtcagctg
aaggagatggccggcgtgcagatgctcgggctgaaaacgaacgccattcggtatctgctc
gaacagctgcccggggtggagaagtgctcgcagtacagtccgctgtaccacaaaaagcag
accggtggcatcgccggcggcccgtacggtgcgggtggagctggcgccggagtgaacggc
ttgggggcgaatggtggagcgtccgagtatgcggactacttcgaggatctgcaggagaac
ccgcacggtacggcccggtgtgagccgtacggtacgcgctcggagtacgacatgttcagc
tggctggcgtcccggcaccgcaagcaaccgatgccgatcgtggcccagaacatcgacgat
acgatcattccaagacgtggcagcggcagcaacctgccgatggcaatgcgctatcgcacg
ctgaaggaatcgtccaaggagtcggtcggcgtctatcggtcgcacatacacggtcgtgga
ctgttctgcaaccgtgacattgaagcaggcgagatggtgatcgagtacgccggtgagctg
atccgctccacgctgacggacaagcgcgagcggtactacgatagccgcggtatcggttgc
tacatgttcaagattgatgagaactttgtcgtcgatgcgacgatgcgtggcaatgcggcc
cgcttcatcaatcattcgtgcgagccaaactgttactcgaaggtggtggacatactgggc
cacaagcacatcatcatctttgccctgcggcgcatcgtgcagggcgaggagcttacctac
gactacaagttccccttcgaggacgttaaaattccgtgctcgtgcggttcgaaaaagtgt
cgcaaatatctcaactaa

DBGET integrated database retrieval system