KEGG   Anopheles gambiae (mosquito): AgaP_AGAP002876Help
Entry
AgaP_AGAP002876   CDS       T01036                                 

Definition
AGAP002876-PA
Orthology
K10800  
single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:aga00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    AgaP_AGAP002876
Enzymes [BR:aga01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     AgaP_AGAP002876
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2R
AA seq 325 aa AA seqDB search
MLRKKLKLDEPSPAAGQPCVPIGEFSLSQFANVPKARLGTSNVPAENAAKIQVNQTKPKP
TTGTVAVPAMSSAGPLPYWQQVYQIERELSAALRQVALPGDVAACYDPIEYAAEIHCAYL
QRFLDGPKPVLFIGMNPGPWGMCQTGVPFGYVPAVRDWMGLRGTVSKPSPELSARPVEGL
ACTREEQSGKRWWGLFEELCGTSDRFFRSCFVYNLCPLAFFHQSGRNITPSELKGKAKGE
IQSISEEFLAKALALLKPTVVVSVGRYTEDRMKTLTKQNRLDPAIVTHCMPHPSPRSLNN
TNWPEKAKSWLTVHGIMPYLSAPGQ
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgtaaaaagcttaaactagacgagccatcaccagccgccggacaaccgtgtgtg
cccatcggtgaattctcactttcccagtttgcaaatgtaccgaaggcaagactgggcaca
tccaatgttcccgctgaaaatgctgccaaaatacaagtgaaccaaacgaaaccgaaacca
acgaccggtacagtagccgtaccagctatgagtagcgctggcccgcttccatactggcag
caggtttaccagatcgaacgagaactttccgcagctctgcggcaagttgccctgccgggg
gatgtggccgcctgctacgatccgatcgagtacgcggccgagattcactgcgcctatttg
cagcggtttcttgacggtccgaagccggtactgttcatcggcatgaatccagggccgtgg
ggcatgtgccaaactggggtaccattcggttacgttccggccgtgcgcgactggatggga
ttgcgtggaacggtatcgaaaccatcgcccgagctatctgccagaccggtggaaggattg
gcgtgtacgcgcgaggaacagagtggaaaacgctggtggggattgttcgaagagctgtgc
ggcacgtcggaccgcttcttccggtcctgcttcgtgtacaatctgtgcccgttggcgttt
ttccaccagagcggacgaaacataacgcccagtgagctgaagggaaaagccaagggagaa
attcaatccatctcggaagaattcctggcaaaggcactggcgctgctaaaaccgaccgtt
gtggtatcggtgggacggtacacggaggaccgcatgaaaacgctcaccaaacagaaccgc
ctagacccggcaattgttacgcactgtatgccgcacccgagccctcgcagcctgaacaac
acaaactggccggagaaggccaaaagctggctcaccgtgcacggtattatgccctatcta
agcgcaccgggtcaataa

DBGET integrated database retrieval system