KEGG   Anopheles gambiae (mosquito): AgaP_AGAP002900Help
Entry
AgaP_AGAP002900   CDS       T01036                                 

Definition
AGAP002900-PA
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:aga00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    AgaP_AGAP002900
Enzymes [BR:aga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     AgaP_AGAP002900
Peptidases [BR:aga01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   AgaP_AGAP002900
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2R
AA seq 901 aa AA seqDB search
MNHPKQLYLGERFDDLEKLYMKLPPDIKDREIDIICRSARKLMEQCDENYIKRDEELAYV
GYMKLINLVQVIRKNKDYARKKEAITRLLGTQSDFNRIFEKLSKLKNSLEARYEERARQR
GGSATLSRAVELERASNGRQPVVGKEAPIVVPIASGQKQSVTATELHAMINDSRVSMLIM
DCRPAKDYEASHLRYAYLVNVPEHLLVAGMTAGKINHALPPESRTLWSNRMVKEQVVLMD
WNTSGVPVKDTPLYILNYTLCHYDQDIEDTKIIRLDGGYESFVLHYPASCTNPSYRPPTV
KPNINMSFPDDIEYPNISDIPMKEESFTKPGFKPTIDRNSKVAAVTLYEARKKPLEDILV
EHEQILDKSKQNALEIINTETELKNLEQQQPLEPGLDETQESLLYEVMQLKDRQRDYEAE
KARILEEEQSYKQLEQEQKERGEQISSEQAEQLEREAYERRYLEEKCQRLARERETKLAL
AREQKRHLKENNVPEPVKRAYPEDDQRSGPYASNATPARMPLFDRSAKPLADHNHNVRTR
DLDVVQRDFAPVYGSVGRGLTGLKNLGNTCYMNSILQCLSNTHFLNEFFHDPSFKMHLNR
NNKTQGKIGEEVAAVIKALWTGQYKCIASKNLRYVVGQYERQFGGIEQQDSHEFLTILMD
WLHSDLQTKQMQVSALDQLPPSEKAWIEHFKGKDSYISELFYGQIKSTVKCTRCHKESAT
YESFSNLSLELPQDSNICYLENCLDMYFNGEEVRGWHCPKCKSNQDAIKKLDISRLPSIL
VVHFKRFYADPDTMATVYRKKQTLVKFPLSELNMTRYLARTEVNRNKRLTTFRYHLYGVS
NHYGSMESGHYTAFCLNNIHQKWFKFDDYNVSSIDASDVQASAAYILFYSCLPDRPQSDV
R
NT seq 2706 nt NT seq  +upstreamnt  +downstreamnt
atgaaccatccgaagcagctgtacttgggcgagcggttcgacgatttggagaagctgtac
atgaagctaccgcccgacataaaggaccgggagatcgatattatctgccggtcggcccgg
aagctgatggagcagtgcgacgaaaactacatcaagcgggatgaagagctggcatacgtg
ggctacatgaagctgatcaacctggtgcaggtcatacggaagaacaaggactatgcgcgg
aagaaggaagcgatcacgcggctgctgggcacgcagtccgactttaatcgcatcttcgag
aagttgagcaagctaaaaaacagtctggaggcccggtacgaggagcgtgcccgacagcgg
ggtggatccgcgaccctgtcccgggcggtagaactggagcgggccagcaacggaaggcaa
ccggtggtgggaaaggaggcgccgatagttgtgccgatcgcttccgggcaaaagcaatcc
gtcaccgcgacggaactgcacgccatgataaacgatagccgggtcagcatgctgatcatg
gactgccgtccggcgaaggactacgaagcgtcgcacctgcggtacgcctatctcgtgaac
gtgccggagcatctgctcgtggcgggtatgacggcgggcaagataaatcacgccctgccg
ccggaatcgcgcacgctctggtcgaaccggatggtgaaggagcaggtcgtactgatggac
tggaacacgtccggcgtaccggtgaaggatacaccgctgtacatcttgaactacacgctt
tgtcattacgatcaggacattgaggacacgaaaatcattcgactggatggtggatacgaa
agcttcgtgctgcactacccggcaagctgtacgaatccctcctatcggccaccgacggtc
aaacctaatataaatatgtcctttccagacgatattgaatatcccaacattagcgatata
ccgatgaaggaggaaagtttcaccaagcccggctttaagccaacgatcgatcgtaacagc
aaggtggcggcagtcaccctgtacgaggcgcgcaaaaaaccgctggaagacatactagtc
gagcacgagcagatactggacaaatcgaagcagaatgcgctggaaattatcaacacggaa
acggagctgaaaaacctagagcagcagcaaccgctcgagccggggctggacgaaacgcaa
gaatcgctcctgtacgaagtgatgcagctaaaggaccggcagcgcgattacgaagcagag
aaagcacgcattctcgaggaggagcaaagttacaagcagctggagcaggagcagaaggaa
cgtggtgaacaaatttcctccgagcaggcggagcaactcgagcgggaagcgtacgaacgc
cggtacctggaggagaaatgccaacggttggcgcgcgagcgtgaaacgaagcttgcgctg
gcccgtgaacagaagcggcatcttaaggagaacaacgtgcccgagccggtaaagcgggct
tacccggaagacgaccagcggtccggcccgtacgccagcaatgcgacgcccgcccggatg
cccctgtttgaccggtccgcgaaaccgctggcggatcataatcacaacgtgcgtacgcgg
gatctggacgtggtgcagcgcgactttgccccagtgtacgggagtgtgggacgcggtctg
accgggttgaagaatttaggcaacacctgctacatgaacagcatactgcagtgcctcagc
aatacgcactttctcaacgaattcttccacgatccgtcgttcaagatgcacctcaaccgc
aacaacaaaacgcagggcaagattggggaagaggtggccgccgtcatcaaggcactgtgg
acggggcagtacaagtgtattgcaagcaaaaatttgcggtacgtcgttggacagtacgag
cgacagttcgggggcatcgagcagcaggattcacacgagtttctcacaatcctcatggat
tggctacattccgatctgcagacgaaacagatgcaggtaagcgccctcgatcagctaccc
ccgtcggaaaaggcatggatagagcatttcaagggcaaggacagctacatctcggaactg
ttctacgggcagatcaaaagtacggtcaagtgcacccggtgccacaaggaaagtgccacc
tacgaatcgttctcgaatctcagcctggagctgccgcaagattcaaacatctgctacctg
gagaattgcctcgacatgtacttcaacggcgaggaggtgcgcggctggcactgtccaaag
tgtaagagcaatcaggacgcgatcaaaaagctggacatctcccggctaccgtcgatactg
gtggtgcacttcaagcgcttctacgccgacccggacacgatggcgacggtgtaccggaag
aagcaaacgctcgtcaagtttccgctcagcgagctgaacatgacgcgctacctggcccgc
accgaggtgaaccggaacaagcggctcaccacgttccggtaccatctgtacggtgtttcc
aaccactacggctcgatggagagcggccactacacggcattctgcctgaacaatatacat
caaaaatggttcaagttcgacgattacaacgtgtccagcatcgatgcgtcggatgtgcaa
gcgagcgcagcgtacattcttttctactcctgcctacccgaccggccacagtcggacgtg
cgataa

DBGET integrated database retrieval system