KEGG   Anopheles gambiae (mosquito): AgaP_AGAP003021Help
Entry
AgaP_AGAP003021   CDS       T01036                                 

Definition
AGAP003021-PB
Orthology
K04646  
clathrin heavy chain
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Lysosome
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:aga04144]
Cellular Processes; Transport and catabolism; Lysosome [PATH:aga04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2R
AA seq 1676 aa AA seqDB search
MSQQLPIRFQEHLQLTNININASSISFTNLTMESDKFICVREKVGETAQVVIIDMNDAQN
PIRRPISADSAIMNPASKVIALKAQKTLQIFNIEMKSKMKAHTMTEEVVFWKWITLNTLS
LVTETSVYHWSMEGDSTPIKMFERHSSLNGCQIINYRTDPKQAWLLLVGISAQQNRVIGA
MQLYSVERKVSQAIEGHAASFATFKMEENKELSTLFCFAVRSQTAAKLHIIEVGTPPAGN
VAFTKKAVDVFFPPEAQSDFPVAMQVSPRYDVIYLITKYGYIHMYDIETATCIYMNRISG
DTIFVTAPHESSGGIIGVNRKGQVLSVTVDEEQIIPYINTVLQNPDLALRMAVRNNLSGA
EDLFVRKFNQLFQNGQFAEAAKVAAIAPKGILRTPQTIQKFQQVPAQPGTNSPPLLQYFG
ILLDQGKLNKYESLELCRPVLAQGRKQLCEKWLKEEKLECSEELGDLVKPSDPTLALSIY
LRSNVPNKVIQCFAETGQFQKIVLYAKKVNYSPDYVFLLRSVMRTNPEQGSGFASMLVAD
EEPLADINQIVDIFMEQNMVQQCTAFLLDALKNNRPAEGALQTRLLEMNLMSAPQVADAI
LGNAMFTHYDRAHIAQLCEKAGLLQRALEHYTDLYDIKRAVVHTQLLNGDWLVGFFGTLS
VEDSLECLKAMLTANIRQNLQICVQIATKYHEQLTTKALIDLFESFKSYEGLFYFLGSIV
NFSQDPEVHFKYIQAACKTNQIKEVERICRESNCYNAERVKNFLKEAKLTDQLPLIIVCD
RFDFVHDLVLYLYRNSLQKYIEIYVQKVNPSRLPVVVGGLLDVDCSEDIIKNLILVVKGQ
FSTDELVEEVEKRNRLKLLLPWLESRVHEGCVEPATHNALAKIYIDSNNNPERFLKENQF
YDSRVVGRYCEKRDPHLACVAYERGQCDRELIAVCNENSLFKSEARYLVRRRDAELWAEV
LSEANPYKRQLIDQVVQTALSETQDPDDISVTVKAFMTADLPNELIELLEKIVLDSSVFS
DHRNLQNLLILTAIKADRSRVMDYINRLDNYDAPDIANIAINNELYEEAFAIFKKFDVNT
SAIQVLIEQVNNLERANEFAERCNEPAVWSQLARAQLQQGLVKEAIDSYIKADDPSAYID
VVETASKNDSWEDLVRYLQMARKKARESYIESELIYAYARTGRLADLEEFVSGPNHADIQ
KIGDRCFNDRMYEAAKLLYNNVSNFARLAITLVHLREFQGAVDGARKANSTRTWKEVCFA
CVDAEEFRLAQMCGLHIVVHADELEDLINYYQDRGYFEELIGLLEAALGLERAHMGMFTE
LAILYSKYKPAKMREHLELFWSRVNIPKVLRAAEQAHLWSELVFLYDKYEEYDNAVLAMM
AHPSEAWREGHFKDIITKVANIELYYKAIQFYLDYKPLLLNDMLLVLAPRMDHTRAVSFF
TKQGHLQLVKTYLRSVQSLNNKAINEALNGLLIDEEDYQGLRTSIDAFDNFDNIALAQKL
EKHELTEFRRIAAYLYKGNNRWKQSVELCKKDRLFKDAMEYAAESHQGELAEELLGWFLE
RGAYDCFAACLFQCYDLLRPDVILELAWRHNIMDFAMPYIIQVTREYTSKVDKLEASDAE
RQKEGESTEHKSIIMPEPQLMLTAGPGIGMPQYAPQYAGAYVPPQPNMPPYQYGGM
NT seq 5031 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaacaacttccgatacgttttcaggagcatttacagctcaccaacatcaacatc
aatgcgagctcgatctcgttcaccaatctgacgatggagtcggataagttcatctgcgtc
cgggagaaggtcggtgagacggcgcaggtcgtgatcatcgacatgaacgacgcacagaac
ccgatccgacgaccgatcagtgccgattcggcgatcatgaacccggcgagcaaggtgatc
gcactgaaggcgcagaaaacgctgcaaatcttcaacatcgagatgaaatcgaagatgaag
gcgcacacgatgacggaggaggtggtgttctggaagtggatcacgctcaacaccctgtcg
ctggtgacggagacgtccgtgtaccactggtcgatggagggcgactcgacgccgatcaag
atgttcgagcgccattcgtcgctgaacggctgtcagatcatcaactatcgcaccgatccg
aagcaggcctggttgctgctagtcggtatttcggcacagcagaaccgtgtgattggcgcc
atgcagctgtactcggtcgagcgcaaggtttcgcaagcgatcgagggccatgcggcctcg
ttcgctaccttcaagatggaggaaaacaaggaactgtcgacgctgttctgctttgccgtc
cggtcgcaaacggcagcgaagctgcacatcatcgaggtcggcacgccgccggccggcaac
gtcgcctttacgaagaaggcggtggatgtgttcttcccgccggaggcgcagagcgacttc
ccggtcgcgatgcaggtttcgccgcggtacgacgtgatctatctgatcaccaagtacggg
tacatccacatgtacgacatcgagacggcgacctgcatctacatgaaccgcatctcgggc
gacacgatctttgtgaccgcgccgcacgaatcgagcggcggcatcatcggcgttaaccgc
aagggccaggtgctgtcggtgacggtcgacgaggagcagatcatcccgtacatcaacacg
gtgctgcagaacccggacctggcgctgcgcatggcggtgcgcaacaatctgtccggcgcg
gaggatctgttcgtgcgcaagtttaaccagctgttccagaacggccagttcgcggaggcg
gccaaggtggcggcgatcgcgccgaagggcatcctgcgcacgccgcaaacgatccagaag
ttccagcaggtgccggcccagccgggcacgaactcgccgccgctgctgcagtacttcggc
attctgctcgatcagggcaagctgaacaagtacgaatcgctcgaactgtgccgcccggtg
ctggcgcagggccgcaagcagctgtgcgagaagtggctgaaggaggagaagctcgagtgc
agcgaggagctcggcgatctggtgaaaccgtccgatccgacccttgccctctcgatctac
ctgcgctcgaacgtgccgaacaaggtgatccagtgcttcgccgaaacgggccagttccag
aagattgtgctgtacgcgaagaaggtcaactacagcccggactacgtgtttctgctgcgc
tcggtgatgcgcaccaacccggagcaggggtccggcttcgcgagcatgctggtggcggac
gaggagccgctcgccgacatcaaccagatcgtggacatcttcatggagcagaacatggtg
cagcagtgtacggcgttcctgctcgacgcgctcaagaacaaccgcccggcggagggggcc
ctgcagacgcgcctgctcgagatgaacctgatgtcggcgccgcaggtggcggacgcgatc
cttggcaacgccatgttcacgcactacgaccgtgcgcacatcgcgcagctgtgcgagaag
gccggcctgctgcagcgcgctctcgagcactacaccgacctgtacgacattaagcgggcg
gtcgtgcacacccagctgctgaacggcgactggctggtgggattcttcggcacgctctcg
gtggaggattcgctcgagtgtctgaaggcgatgctgacggccaacatccgccagaatctg
cagatctgcgtgcagatcgcgaccaagtaccacgagcagctgacgacgaaggcgctgatc
gacctgttcgagagcttcaagagctacgaggggctgttctacttcctcggctcgatcgtc
aacttcagccaggatccggaggtgcacttcaagtacatccaggccgcctgcaagaccaac
cagatcaaggaggtggagcgcatctgccgcgagtcgaactgctacaatgcggagcgcgtc
aagaacttcctgaaggaggcgaagctgacggatcagctgccgctcatcattgtgtgcgat
cggttcgatttcgtgcacgacctggtcctgtacctgtaccgcaacagtctgcagaagtac
atcgagatctacgtgcagaaggtgaacccgtcccgtttgccggtggtcgtgggcggcctg
ctcgacgtcgactgctccgaggacatcatcaagaacctgatcctggtcgtgaagggccag
ttctctaccgacgagctggtggaggaggtcgagaagcgcaaccggctgaagctgctgctg
ccgtggctggagtcgcgcgtccacgaaggttgcgtggagccggccacccacaacgcgctg
gccaagatctacatcgactcgaacaacaatccggagcgtttcctgaaggaaaaccagttc
tacgacagccgcgtggtgggacgctactgcgagaagcgcgatccgcatctcgcgtgcgtt
gcgtacgagcggggccagtgcgatcgcgagctgatcgcggtttgtaacgagaattcgctg
ttcaagtcggaggcccgctacctggtgcgccggcgcgacgccgagctgtgggcggaagtg
ttgtccgaggcgaacccttacaagcggcagctgatcgaccaggtggtgcagacggccctg
tccgagacgcaggacccggatgacatctccgtcacggtgaaggcgttcatgacggccgat
ttgccgaacgagctgatcgagctgctggagaagatcgtgctcgactcgtccgtcttctcc
gaccatcgcaacctgcagaatctgctcattctgacggcgatcaaggcggaccgtagccgc
gtgatggactacatcaaccgcctggacaactacgacgcgcccgacatcgccaacattgcg
atcaacaacgagctgtacgaggaggcgttcgcgatcttcaagaagttcgacgtgaacacg
tccgccatccaggtgctgatcgagcaggtgaacaatctggagcgtgcgaacgagtttgcc
gagcgctgcaacgagccggccgtctggtcgcagctggcccgcgcccagctccagcagggc
ctggtgaaggaggcgatcgatagctacatcaaggcggacgacccgagtgcctacatcgac
gtggtcgagacggcgagcaagaacgactcgtgggaggacctggtgcgctatctgcagatg
gcgcgcaagaaggcgcgcgagagctacatcgagagcgagctgatttacgcgtacgcccgc
acgggccggctggccgatctggaggagtttgtgtccggaccgaaccatgccgacattcag
aagatcggcgaccgctgcttcaacgaccgcatgtacgaggcggccaagctgctgtacaac
aacgtgagcaactttgcccggctcgcgatcacgctggtgcatctgcgcgagttccagggc
gcggtggacggtgcccgcaaggccaactcgacgcgcacctggaaggaggtgtgcttcgcc
tgcgtcgatgcggaagagttccggctggcgcagatgtgcggtctgcacatcgtggtgcac
gcggacgagctggaggatctgatcaactactaccaggaccggggctacttcgaggagctg
atcgggctgctggaagcggccctcgggctggagcgcgcacacatgggcatgtttaccgag
ctggcgattctgtactccaagtacaagccggccaagatgcgcgagcatctggagctgttc
tggtcgcgcgtcaacattccgaaggtgctgcgggccgccgagcaggcgcacctctggtcc
gagctcgtgttcctgtacgacaagtacgaggagtacgacaacgcggtcctcgccatgatg
gcgcatccgtccgaggcgtggcgcgaagggcacttcaaggacatcatcaccaaggtggcc
aacatcgagctgtactacaaggcgatccagttctacctggactacaagccgctgctgctg
aacgatatgctgctcgtgctggccccccgcatggaccatacgcgcgccgtcagcttcttc
accaaacagggacacctgcagctcgtcaagacgtacctgcggtcggtgcagagcctgaac
aacaaggcaatcaacgaggcgctgaacgggctgctgatcgacgaggaggactatcagggc
ctgcggacgtcgatcgacgcgttcgacaactttgacaacattgcgctggcgcagaagctc
gaaaagcacgagctcaccgaattccgtcgcattgctgcctacctgtacaaaggaaacaac
cgctggaagcagagcgtggagctgtgcaaaaaggaccgactgttcaaggacgcgatggag
tacgcggccgagtcgcaccagggcgagctggcggaggaactgctcggatggttcttggag
cggggcgcatacgattgcttcgcggcatgtctattccagtgctacgatttgttgcggccc
gatgtaatactagagctcgcatggcgccacaacatcatggactttgctatgccttacatc
atccaggtgacgagagaatacacctccaaggtagacaagctggaagcgtccgatgccgag
cgacagaaggagggcgaaagcaccgaacacaaatccatcatcatgcccgaaccgcaactg
atgctgactgctggccccggtatcggcatgccccagtatgcgccacagtacgccggcgcg
tacgtgcccccgcaaccaaatatgcccccataccagtacggtggtatgtaa

DBGET integrated database retrieval system