KEGG   Anopheles gambiae (mosquito): AgaP_AGAP003049Help
Entry
AgaP_AGAP003049   CDS       T01036                                 

Definition
AGAP003049-PB
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:aga00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    AgaP_AGAP003049
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    AgaP_AGAP003049
Enzymes [BR:aga01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     AgaP_AGAP003049
Lipid biosynthesis proteins [BR:aga01004]
 Desaturase
  First
   AgaP_AGAP003049
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2R
AA seq 402 aa AA seqDB search
MTVGITSTLQFIAGNSAQYMKPGPNGQSQHAAAAAAAAAASSTVPDTNNNEMEDDRTVSD
KDIDSYLKHYNRWQQSAWGRTLSDLVKRYLGYEFEDEVKWNNVFMIGIFHVIAVWSFLHY
VWQATPITYLWGFFVGGCAGFGVTGGVHRLWCHRSYKAKLPLRIILMCCYSIAGQNTIYD
WVRDHRIHHKYSETNGDPHNANRGFLYAHVGWLMLRKHPECIKKGRLIDMSDIVSDPVVQ
FHHKNFVLMKLLFCFILPTFIPWYFFGETFLMSFFSQCFVRYVLSLNFTWLVNSAAHLYG
NHPYDKRINPAENRAVSVVAMGEGWHNYHHVFPWDYKAAELGNYSVNVTTFWLDVFAKIG
WAYDLKEPSKDLVRRTIEKYGDGTHITARIGHMEEVPAPADS
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgacggtgggcattaccagcacgctacagttcatcgccggcaattcggcgcagtacatg
aaacccggcccgaatggtcaatcacagcacgctgcggctgcggctgcggccgctgcagcc
agctccaccgtcccggacacgaacaacaacgagatggaggacgatcgtaccgtaagcgac
aaggatatcgacagctatctcaagcactacaaccgttggcagcagtccgcctggggccgc
acgctctccgacctggtgaagcggtacctcggctacgagttcgaagacgaagtcaagtgg
aacaatgtgttcatgatcgggatctttcacgtgattgcggtgtggtcctttctgcactac
gtatggcaggccacaccgatcacctatctctggggtttcttcgtcggcggctgtgccggg
ttcggggtgacgggcggcgtacaccgcctctggtgccaccggtcgtacaaggcgaagctg
ccgctgcgcatcatcctgatgtgctgctactcgatcgccggccagaacacgatctacgac
tgggtgcgggaccatcgcatccaccacaagtactcggaaacgaacggtgatccacacaac
gcgaaccggggcttcctgtacgcgcacgtcggctggctgatgctgcgcaagcatccggag
tgcatcaagaagggccggctgatcgatatgtccgacatcgtgagcgatccggtcgtgcag
ttccaccacaaaaactttgtgctgatgaagctgctgttctgctttatcctgccgacgttc
ataccgtggtacttcttcggcgaaacgttcctgatgtccttcttcagccagtgtttcgtg
cggtacgtgctcagtctgaactttacctggctggtcaatagcgccgcccacctgtacggt
aaccatccttacgataagcgcatcaatccggcggaaaaccgtgccgtttccgtggtggct
atgggcgaaggatggcacaactaccatcacgtgttcccgtgggactacaaggcagccgag
ctgggcaactactcggtcaacgtgaccacgttctggctggacgtgttcgccaagattggc
tgggcgtacgatttgaaggaaccgtccaaggatctggtgcgaaggacgatcgagaagtac
ggtgatggtacacacattactgcccggatcgggcacatggaggaagttccagcaccggcc
gactcctag

DBGET integrated database retrieval system