KEGG   Anopheles gambiae (mosquito): AgaP_AGAP003114Help
Entry
AgaP_AGAP003114   CDS       T01036                                 

Definition
AGAP003114-PB
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:aga00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    AgaP_AGAP003114
Enzymes [BR:aga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     AgaP_AGAP003114
Protein phosphatases and associated proteins [BR:aga01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     AgaP_AGAP003114
Transcription machinery [BR:aga03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     AgaP_AGAP003114
Spliceosome [BR:aga03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    AgaP_AGAP003114
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2R
AA seq 328 aa AA seqDB search
MGDYTLDVDNLIQRLLEVRGCRPGKSVPMPEEEIRALCLKSREIFLQQPILLELEAPLKI
CGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLL
RGNHECASINRIYGFYDECKRRYNVKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLN
HMEQIKRIMRPTDVPDTGLLCDLLWSDPDKDVKGWGENDRGVSFTFGVDIVAKFLLIHEL
DLICRAHQVVEDGYEFFARRSLVTLFSAPNYCGEFDNAGGMMSVDANLMCSFQILKPSEK
KAKYQYSGTNNQRPQTPQRNQNPTNKRK
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgggcgactacacgctggatgtggacaatctgattcagcgactcctagaagttcgggga
tgtcgtccaggaaaatcggtacctatgccagaggaagaaattcgtgcgctatgcttaaaa
tctcgtgaaattttcctacaacaaccaatcctgttggaactggaggctccacttaaaatc
tgtggtgacatacacggccagtacacagacttgctgcgactgttcgagtacggtggattc
cccccggaggccaattatttattcttgggagattacgtggaccgaggcaagcagtcgctg
gaaacgatctgtctcctgttagcgtacaaaatcaagtatccggaaaactttttcctgctg
cgcggaaatcacgagtgtgccagtattaataggatatatggtttctatgacgagtgcaag
cggcggtacaatgtgaagctgtggaaaacattcacggactgtttcaattgcctgccgatc
gctgccatcattgatgagaaaatcttctgctgtcacggaggtttaagtccggatttgaac
catatggaacaaatcaaacgcatcatgcgaccaacagatgttcccgatacgggcctactg
tgcgatctgctgtggagcgatccggacaaagatgtgaaaggatggggagagaacgaccgt
ggcgttagcttcacgttcggcgtagatattgtggcaaagtttctgctaatccatgagctg
gatctcatctgccgggcgcatcaggtcgtggaggacgggtatgagttctttgcccggcga
tcgctggtgacgctgttctctgcaccgaactactgtggtgaatttgacaatgccggcggc
atgatgtcggtcgatgcaaatttaatgtgttcgtttcagattttgaagccgtcggaaaag
aaggctaaatatcagtacagcggtactaacaaccagcgaccgcagacgccccagcgcaat
cagaatccaaccaataaacggaaataa

DBGET integrated database retrieval system