KEGG   Anopheles gambiae (mosquito): AgaP_AGAP003264Help
Entry
AgaP_AGAP003264   CDS       T01036                                 

Definition
AGAP003264-PA
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
aga  Anopheles gambiae (mosquito)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
Position
2R
AA seq 418 aa AA seqDB search
MSQLADLKGYVSYALDCTRFRLVRDESDVENEELVFAPEMAHQIFGESESIFGYRDLKIE
IMASAGPLDLYFDISYAKKVEELQTEGLKADDVEKSLASIVENASYYTNLDEFKRVHASK
APSFRPVGTKVDEFKHPLDGTEPGSRTFEVYVSSAEDAEYMKFHTRLEMFSFWYIDGFSR
VEIDPLWLFFTVYERYELENNNGSVEGDVSNVRYATVGYVSVYQYYSYPNKVRPRISQIL
ILPPFQKLGIATRLIKHSTYDYFRKKDNITDITFEEPIEAIQHIRSVVDARRCKQLPAFT
REKLLAGFSKEMLHAARETYLINPKQCRVVYEILRLGVTDLDNEEQYRAYRLEVKKRLNM
NYSRHRRDLARAKKRGVDVTAAMCGLPSVSERIESLNAEYKEVEEIYGQVLQKLLAEH
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagctcgcggacctgaagggatacgtcagctacgcgctggactgcacccggttc
cgcctggtgcgcgacgagtcggatgtggagaacgaggagctagtgtttgcgccggagatg
gcgcaccagatatttggcgaatcggagagcatctttggctaccgcgacctgaagatcgaa
atcatggcctcggccggtccgctcgatctgtacttcgacattagctacgcgaagaaggtc
gaggagctgcagacggagggcctgaaggcggacgatgtggaaaagtcgctggcgagcata
gtggagaacgcgagctactacacaaatttggacgagttcaagcgtgtgcatgcgtcgaag
gcgccctccttccggccggtcggtacgaaggtggacgagttcaagcatccgctcgacggg
acggagccgggctcgcgcacgttcgaggtgtacgtatcgagcgcggaagatgccgagtac
atgaagttccatacgcggctggagatgttttcgttctggtacatcgacgggttcagccgg
gtggagattgatccgctctggctgtttttcaccgtgtacgagcgctacgagctggagaat
aacaacgggtcggtggagggcgacgtgtccaacgtgcggtacgccaccgttgggtacgtg
agcgtgtaccagtactactcctacccgaacaaggtgcggccacgcattagccaaattctc
atactgcccccattccaaaaactgggcattgcgacgcgactgatcaagcatagcacgtac
gattacttccgcaagaaggacaacatcacggacatcacgttcgaggaaccgatcgaggcg
atccagcacatccgctcggtggtggacgcgagacggtgcaagcagctgcccgccttcacg
cgcgaaaagctgctggccggcttctcgaaggagatgctccatgcggcccgcgaaacctac
ctcatcaatccgaagcagtgccgggtggtgtacgaaatcctgcggctcggcgtcaccgac
ctcgacaacgaggagcagtaccgagcgtaccggctggaggtaaagaagcggctgaacatg
aactacagccgccatcggcgcgatctggcccgggccaagaagcgcggcgtggacgtgacg
gccgccatgtgcggactgccgagcgtttccgagcgcatcgagtcgctgaacgcggagtac
aaggaggtggaggagatctatggccaggtgctgcagaagctgctggccgaacactag

DBGET integrated database retrieval system