KEGG   Anopheles gambiae (mosquito): AgaP_AGAP003365Help
Entry
AgaP_AGAP003365   CDS       T01036                                 

Definition
(RefSeq) AGAP003365-PA
  KO
K04430  mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
aga04013  MAPK signaling pathway - fly
Module
aga_M00688  MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:aga00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    AgaP_AGAP003365
Enzymes [BR:aga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     AgaP_AGAP003365
Protein kinases [BR:aga01001]
 Serine/threonine kinases: STE group
  STE7 family
   AgaP_AGAP003365
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase DUF5085 Seadorna_VP7 Choline_kinase
Motif
Other DBs
NCBI-GeneID: 1275042
NCBI-ProteinID: XP_314266
VectorBase: AGAP003365
UniProt: Q7Q999
Position
2R
AA seq 371 aa AA seqDB search
MPLPLELNGERRKPSKKLSFQGCQGGQAPVIPDPTRERIRMQATAGKLQIAPNQTYDFTS
EDMIDEGEIGRGAFGAVNRMKFTHTGTVMAVKRIRSTVDEKEQKQLLMDLEVVMKSNDCN
TIVTFYGALFKEGDCWICMELMDTSLDKFYKFICEKQQSPIPEPILAQITFATVRALNYL
KEELKIIHRDVKPSNILLKRNGDIKLCDFGISGQLVDSIARTKDAGCRPYMAPERIDPQR
AKGYDVRSDVWSLGITLMEVATGKFPYPKWGSVFEQLSQVVEGDPPRLSTTYNGMEFSID
FVNFVNTCLIKDERDRPKYGRLLQHPFIQQAEKSDTDVAAYVSEVLESMANNGITQFTTD
LPAEGWNESFN
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgccactgccgctggaactgaacggcgagcgaaggaaaccgtccaaaaagctcagcttc
caaggatgccagggcgggcaggcgccggtcataccggatccgacgcgcgaacgcatacga
atgcaggcgacggcgggcaaactacagatcgcgccgaaccaaacgtacgacttcacctcg
gaagacatgatcgacgagggtgaaatagggcgcggtgcgttcggtgccgtcaaccggatg
aagttcacgcacacgggcacggtgatggcggtgaagcggatccgctcgaccgtggacgag
aaggagcagaagcagctgctgatggatctggaggtggtgatgaagtcgaacgactgcaac
accatcgtcacgttctacggggcactgttcaaggagggcgactgctggatctgcatggag
ctgatggacacgtcgctagacaagttctacaagtttatctgcgaaaagcagcagagcccc
atcccggaaccgatactggcgcagatcacgttcgcgacggtccgcgcgctcaactatctg
aaggaggagctgaaaattatccaccgggatgtaaaaccgagcaatatactgctgaaacgg
aacggcgacattaagctgtgcgatttcggcatctccggccagctagtggattcgatcgca
cgcaccaaggatgccggctgccggccgtacatggcgcccgaacgcatcgatccccagcgc
gctaagggttatgacgtgcgcagtgacgtgtggtcgctcggaattacgctgatggaggtg
gcgaccgggaagttcccctatccaaagtggggctccgtgtttgagcagctttcacaggtt
gtcgaaggtgacccgcctagactgtccaccacctacaatgggatggaattttcgatagat
tttgtaaattttgtaaatacctgtttaataaaggacgagcgcgatcgtcccaagtacggt
cggctgttgcagcatccgttcattcagcaggccgaaaagagtgacactgacgtagcggcg
tacgtaagcgaagtgctggaatcgatggccaacaatggtatcacgcagtttaccacggac
ctgccagcggaaggttggaacgaaagcttcaattag

DBGET integrated database retrieval system