KEGG   Anopheles gambiae (mosquito): AgaP_AGAP003418Help
Entry
AgaP_AGAP003418   CDS       T01036                                 

Definition
AGAP003418-PA
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:aga01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:aga01040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2R
AA seq 409 aa AA seqDB search
MAPNVLGNTILLAEACIEQEDNNNNASIGTQQYKSKSFLNVAPKPAPITEELKPKDATQA
AIASRERRYHHVYVWRNIIAFIYLHLGFLYGSYLLVTSAKWSTFFFALALGSCGALGITA
GAHRLWSHRAYKAKWPLRLFLMLAQTLAFQNSVYEWVRDHRVHHKFTDTDADPHNATRGF
FFSHIGWLMVKKHPDVKARGRAVDMSDLEQDGIVMFQKRYYALLMPLFCFILPTFLAYYY
LDETFSNAWYVVAIFRYVLSLNATWLVNSAAHIWGTKPYDRNISPTNNTFVAIAAYGEGW
HNYHHVFPWDYKTSELGTYSTNFTTAAIDFFARIGWAYDLKSVSDELIRKRVLRTGDGSH
QYNEQELQARMVDYVNQLDHESEQAVWGWDDKDMNEQDRQDATVRNKAD
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggcaccgaacgtgctcggcaacacgatactgctggcggaggcctgcatcgagcaggag
gacaacaacaacaacgcatcgattggcacgcaacagtacaagagcaaatccttcctgaac
gtagcgccgaaaccggcgccgattacagaggagcttaagccaaaagatgccacgcaagct
gcgatagcgagtagagagcgccggtatcaccacgtgtacgtgtggcgtaacatcattgcg
ttcatctatctgcatctgggctttctgtacggcagctacctgctggtcacgtcggcgaaa
tggagcacatttttctttgcactcgcgctgggctcgtgcggtgcgctcggcatcacggcc
ggcgcccaccggctctggtcgcaccgggcgtacaaggcgaaatggccgctccgcctgttc
ctgatgctagcgcagacgctagcgttccagaacagcgtgtacgagtgggtgcgggaccat
cgcgtccaccacaagttcaccgataccgatgcggacccgcacaatgcgacccgcggcttc
ttcttctcgcacatcggctggctgatggtgaagaagcatccggacgtgaaggcgcgcggc
cgggccgtcgacatgagcgacctcgagcaggacgggatcgtgatgttccagaagcgctac
tacgccctgctgatgccgctgttctgcttcatcctgccgaccttccttgcctactactat
ttggacgagacgttctcgaacgcctggtacgtggtggccatcttccggtacgtcctgtcg
ctgaacgcaacctggctggtgaacagtgcggcccacatctggggcacgaagccgtacgat
cgcaacatttcgcccaccaacaacacgttcgtggcgatcgcggcgtacggcgagggctgg
cacaactatcaccacgtgttcccgtgggactacaaaacgtccgagctgggcacgtacagc
acgaactttacgacggcggcgatcgactttttcgcccgcatcggctgggcgtacgatctg
aagtccgtgtcggacgagctgatacgcaagcgcgtgctgcgcaccggcgacggttcgcac
cagtacaacgagcaggagctgcaggcgcgcatggtcgactacgtcaaccagctcgatcac
gagtcggagcaggcggtgtggggctgggacgataaggacatgaacgagcaggaccgccag
gatgccaccgtcagaaataaggccgattag

DBGET integrated database retrieval system