KEGG   Anopheles gambiae (mosquito): AgaP_AGAP003643Help
Entry
AgaP_AGAP003643   CDS       T01036                                 

Definition
AGAP003643-PA
Orthology
K11853  
ubiquitin carboxyl-terminal hydrolase 34 [EC:3.1.2.15]
Organism
aga  Anopheles gambiae (mosquito)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2R
AA seq 4619 aa AA seqDB search
MCDVCSGFLNLLVSYESRLHGSNDTDQPVFLQKREVEIVLNYIQTWPNRQCMCCYRDVKN
FERFNLVLQGIICFTVHQLKHIRKLLAQNQLQTSASATGAGQTLPGAANVSEASGASDPG
GSNATAEDGNEKTGTDGQAPTCKSPTDSADCGQADVTSKEAEHSGAGEAGAGSKHAPTDD
RRHAERQQSAVTSNQHTMDEQWTLLDVEKLLILVSKVFLLNFPLYVAYKHSVHTRLEDVS
PQEVQSLSLFCDLHETEISAFLLRNVSLFCNYGGFEAMMHCFDQPGLPVSTAHAITATSS
NIKLWINYRSTMQLFIPLRVKVLQYMCRLSDQDLRSPATKSMADFMWTAIKDPFDSQITF
DTEGLALAFKYFTSSTLTMRLAGMAQINAHINMFNDICTSETVSEVEAVGLKLANWLSEN
QIISHLFGPNLHVEVIKQSHIVLNFLAVENQITEEHITLMWQAAQLKHCSKTIYDILPSL
VKNLAPTPATHLYSLLCRLDPKEHTEQSIYITSALTKLIWMRDCSRQTLIDMSKSAGNTI
NDIATGRGDYNELPSSSENSVSVDGTNSEDEHPEDDSSDPDVPSSVVPVVVAGGHKPPGP
MLGMVPDREGESDNGAPPCKQARHKICCDETTDDSIKVEPDIYNVQRNKEKIRIPLMTRS
INTFNEEGTSSDDGIDMDEAFLMRKKLRKKRRKISGLTRKELQELHESVSDVEDSDLLAA
MLPDSDCSDNNLQTSVLRHIQQQQQQQQQQQQQAQQHHHHHHHHHGGPLGPGIVGMSERE
QQLVARAGNSLMGAAGVASLGDDVSNFMGAMGEGRLINFLNAADAADHDGSCSSPMSNKS
EKNMADFDDEDSPCEEELAQLAARAESLHQGFPISRPRSIGTVAGPSPLRAGAAGMGMMK
HLPHQHSPGMHRMGANNGAIKMGKGGSTKTKDILQATAAAAASAGPVGTMMIGTPYRFPD
VCLPGNTLLWDLLQDDKIGQLGESIALEAEKVLGTLLCFHTDKHIRTRFIEGCLQNLAEN
RSVVTSLKLLPKLFASFQQFRDVTTHQVVLWSERQHRMMFHFFNNLKHYTSTFRNSAGAA
SVVLPPSDGTGQCGPLYSHVTQIQVRLQFLTSVFSDVGSPRSFRLTLNQVDSLWACLAND
PECSDCLFSWLQAQVKGGDTHALGLNAIQHLYLKRLSELKPEGISMVALGLFQQLFTLGR
EEIFGQPVDGGERDRETDTVGMEHLWKIALRATNTDVSLSAIQYINTYYMEKQLKYEHQF
VAQCMNHLSQAVEELNQHSDNNGPATEYALMCVQRALMLLNTHLDTFRRRYAYHLRRWAL
EGKDIGAHSALRTEGPGPPIRIVLQPAGVPDKSFLNMHASDLVADLKAEIAKWWEKYQAA
PQAKTAPANNTSTPGSGGEQNSAGGGSPAPVLGLLLNDGPLRIITQGQEITSEYDERSLA
DVGFKDNQMVYVSLGGRSGRRREQSENPSMQPPPPKDCLPTLLLLKPPYFEQLFRLMQTL
GDMKISTTGERCQPNTKAQLLSRRVWDILAMLPTCPSFFSTLKNLSFKCAARPKTDEQCE
EELGEAKLPQQRGDESAEGSVKETDPLLGGCYTLEEILDPYNLQKFMYALHIVESLCKSK
FVGNCCGSGAGGVMHLKQVPFTEGGNNRGTVGVAGTSSKTLLVKNQLKLKISSSKSLKMQ
QQSGTPRQETSVAAATSNRSPSKGGKRVDFAPTSPGPGVVKPTPLCSEDERSAVLAKDRA
DESAENKENTPNCDGATSKPEEQRTGETQQAIECEPEGANTGNAQQDPVQVDEPKKSERN
RDAEADRNESCASSSRVVEWSDEFMRCGGLAHLYRIFLSGVLQKSTDGSDESELNEWRHD
CLASLLRIMCLLGMDELKATEAEGNAILIPPLNRETLALFEPRPTLERIASILNEESLPV
NPNLFKTGLFGRPQVIHYAMNLLVCYAHSCKEVRRLLWTIEANSLWLQRLILDDPEPAVR
REACAALYRLCLGNAQTYYELMAPLLSKLVALLPLAENMKPQSLTGGPGGGIYGALLSAG
DETKEPYGPACRDYFWLLCRLVDALSPELLRGNAGHSAGDELQPRDAIGLDDMCQQVARS
ILERDYLESRHGSPDDGLFGLLNLMANLLKFDPAFKYSLVGQEFMISVFCCLFELPSPED
REKPKCKSHAARAAAYDLLVEMCRNAPKNYLLLHGKLMQQHRAGPHSPYPWDYWPQDEGR
SECGYVGLTNLGATCYMASCIQHLFMTPQTRDAILSISTDAPQKHKATLCELQRMFAYLM
ESERKAYCPRSFCRVYQMDHQPLNTGEQKDMAEFFIDLVSKLEEMTPDLKNLVKRIFCGV
ISNNVVSLDCGHVSRTLEEFYTVRCQVADMRNLHESLDEVTVKDTLEGDNMYTCSQCGKK
VRAEKRACFKKLPQILCFNTMRYTFNMVTMLKEKVNTHFSFPMRLDMSGYVEKTLMPHHY
QEEKRKSQMRRSHSRNVSESSATGEVNPAGTSGLDDNSSSSASSSTSTGLMSTGSECGNG
GNKTNGPAPAVEKQQESEDVEMKNASSDEKDGADDRKNDSSNGNLSDSSNGDLQRQQQTM
DEEESEDFNEHYEYDLVGVTVHTGNADGGHYYSFIKERNEDGDPNHQERWFLFNDAEVKL
FDPTQIAAECFGGEMTSKTYDSVAEKYLDFSFEKTNSAYMLFYEWRSNKGKNVQRDQAEE
QQATNSATSAPSAEKRSSTASNSSVDSDKRTLNNATTGSSGRSPTKTPIKSAGVSERGSS
SKQQDPTPELTDGGHFSNRKATMPSQSSSFSSTPFSMAQASFSAASPLPASTAATSGGPS
FKVAPNTNSKAALAQDPLPSNLGPSKDCHQPVYATAVGQGPASARNERDQETEQFIQQPS
EVAKQSNNLSKCDIDTKHASTARIPSTTSSQQQQQQQEVEVTSTRVVSPTPTTASLASTA
SLSPTSTASTASVASAGAAPTAITVPTTVPSAQSVPSSVSASTPLHPVIVPPLAGSSIST
APVSSCLGVLGGPGPAAVAASSVIGFQGSTSSATSPSAMLHGVVPEPAPSSYSSISSLSA
LTATVGGNIALPMAAVVGPTPGGPGSSFSAVATHAVLQASSSPGCSSSSGSGSSGSSGLV
MVNRINHSSKRLRRRPLSKELEEWIWQDNRHFLQDRNIFEHTYFNFMWQICGQIPQNLLA
LPDITCIAAQLSVSFFIETFIHAKEKPTMVLWVELLTKQFNASQEACEWFLSHMSAEPWW
PVQVLIQCPNQMVRQMFQRLVIHVIQRLRQSHCSLYLKAETDLDGNEIIGNVSCVTRFIK
SLIMLMEHGAKAHSRHLSEFFGLLYEFSRMGEEEALFLLRINVIRSVADFYLGHKGQECM
DANSDNEENSSDEALTVDKSRPASLDKMIALVASLVERSRGPDLRLHLSARDYNAIAGGK
GFPFLYQQIKDNINPQQTRHLIHALCRCDERLASQIIAMLFTAVTKHTELCGPFFKLITL
LTESSGGPSGLPCFSQLVLQRVWDAAEYCPQSALDWLAVQAPRNKIVHNWILQSADSWVE
RFLLAHGNARVRNAAAYLLVSLVPSQSFRNNYRATSHHKLSMHVFQHREISCEAQLILHT
ILNMLLLLLRSARNYTDINVHGTSKFTAYFNLLTYCLVSKTEKLMVGPHLRALWDLFHPR
LSEPAVPAHHNKQALLAFWYQATLDCPENANLVANCPDITRNIAFNYILADHDDTEIVTY
NRAMLPVYYGLLRMCCQQSRLLTRQLAAHQNLQWAFKNITPHPTQYPLAVDELFRLMTLF
AQRHPEASEAEQRDVTIFRRTTLTAYLNGLDARVSWGTLIAALRILVDNDDDRLYVVLNG
GITLCFDALHTLHSMYHEATACHVYGDLQELLTEVILLINTLRASSREQKKRPQPALMKG
LPDAVRRLATLLNTFNPPEMRNLALEVLKELVKCAPPDIITTVLVPLLTSCHAPHVHHLI
HQANSAGSGSAAATANAAAASAAAAAASAAAAAAASSIGPLGSYFPRRGMKAAWPPVSKN
TPRPPKAMVQMNIPQSQICEKGLDKDFDLALELFYRPYHEFLDIMFRVAVTSNHFTEPLV
HLSLLTGIEGVVLHFNIFAKFWVGIYNNKTTHRYADMLIKNPLLIDYIDNILRDERLSLN
DPIIANFIEIYYPKIKSRLVVPRLLESICQLLPDKNNLEDICGDLQAIRIIGQRTGIPSS
VKGALQNSLHAVLTKFKDEIYSDEEVPTKKRKVTVPHITIHPVVRSPSSGGNVSAAQVLP
ETGHSAAGAAAASVSETTLAKATRLKETIPPSIEITVQNKPTPSVGAAVGAGGGVIKQPI
GAESPSSSNEARNQPTSSKNPAPEAAAAVSEATRPIQPSSPSSGEKEAEKAGEQSAGEND
IIGPTALDAGTTSEQNLNQQQQQKQQEQYLRNLVKDIESHIELIFECLDDDEGENANDTN
NAKSHHHQPQHDETVERQPETSGKVLPENHATSNNPPTKPESSPTAVSMGAAMSTSSAAE
GMEQGDDLTVASSSSTSAGCQTAVDETLTAAEELAARRKLGDNGDTGRQSPAGSKLQKKP
IESQEPQGIGVTNSSSSGEGGFVMAGTQPLLDTQDTNSQVGPETSGKENTSSTSDTIED
NT seq 13860 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgatgtttgctccgggtttctgaatcttcttgtttcgtacgagtccagattgcac
ggcagcaatgacaccgatcaaccggtgttcctgcagaagcgcgaggtggaaatcgtcctc
aactacatccaaacgtggccgaacaggcagtgtatgtgctgctatcgggatgtgaaaaac
ttcgagcggttcaacctggtgctgcagggtataatctgttttaccgtgcaccagctgaaa
cacattcgcaagctgttggcacaaaaccagctgcagacatcggcgagcgcgaccggagct
ggacagacgctgcccggtgctgcgaatgtgtcggaggcgtcgggtgcatcggacccgggt
ggcagcaatgcaacagccgaggatgggaacgaaaagacgggaaccgatggtcaggcacca
acctgtaagtctccaacggacagcgccgactgtggccaggcggatgtcacatccaaggag
gcagagcatagtggtgctggcgaggcgggtgctggatcgaagcatgcgcccactgatgac
agaagacatgccgaaaggcagcagtccgcggttacgagcaaccaacacacgatggacgaa
cagtggacactgctggacgtggagaagctgctgattctggtgtcgaaggtgttcctgcta
aatttccccctgtacgtcgcgtacaagcacagtgtgcacacgcgcctggaggacgtttca
ccgcaggaggtgcaatcgctcagcctgttctgcgatttgcatgagaccgaaatttcggcc
ttcctgctgcgcaacgtttcgctgttctgcaactacggcggctttgaggcaatgatgcac
tgctttgaccagcccggactgcccgtctcgacggcccatgccatcacggccacgagctcc
aacataaagctgtggatcaactaccgctccaccatgcagctgttcatcccgttgcgcgtg
aaggtgctgcagtacatgtgccggctgtccgatcaggacctccggtcgccggccacaaaa
tcgatggccgacttcatgtggaccgccatcaaggatccgttcgattcgcaaattacgttc
gacacggaggggctggcgctagcgttcaagtacttcacctcctccacgctgacgatgcgc
ctggcgggcatggcgcagatcaacgcgcacatcaacatgttcaacgacatctgcacctcg
gaaaccgtgtccgaggtggaggcagtcgggctgaagctggccaactggctgtccgagaac
cagatcatctcgcacctgttcggaccgaacctgcacgtggaggttatcaagcagtcgcac
atcgtgctgaactttctagcggtcgaaaaccagatcaccgaggagcacatcacgctgatg
tggcaggcggcccagctaaagcactgctcgaagacgatctacgacatcttgccctcgttg
gtgaagaacctcgcaccgacaccggcgacccacctgtactcgctgctgtgccggctggac
ccgaaggagcatacggagcagagtatctacattacgtccgcactgacgaagctgatatgg
atgcgggactgctcgcggcaaacgctcatcgatatgagcaagtcggctggcaacaccata
aatgatattgcgacgggccgcggggattataacgagctgccatccagctcggagaacagc
gttagcgtcgatggcaccaacagcgaggacgagcatcccgaggatgacagttccgatccg
gacgtgccatcatcggtggtgccggtggtggtagccggtggccataagccgcccggaccg
atgctgggcatggttccggaccgcgagggagaatccgacaatggggctcctccttgcaag
caggcgcgccataaaatttgttgtgatgaaactacggatgacagcatcaaggtagaacca
gatatttacaatgttcagagaaataaggagaaaataagaattcctctaatgacacgctcg
atcaacacgttcaacgaggaaggtacgagcagtgacgatggcatcgatatggatgaggcg
tttttaatgcgcaaaaagctgcgcaaaaaacgtcgcaaaataagcggactcacgcgcaaa
gagttgcaagagctgcacgaaagcgtttcggacgtggaggatagtgatctgctcgctgcg
atgctaccggacagcgactgtagcgataacaacctgcagacatccgtgttgcgccacatt
caacagcagcagcagcagcagcaacagcagcaacagcaggcgcagcagcatcaccatcat
caccaccatcaccatggtggcccgctcggtccaggcatcgttggtatgagcgaaagggag
cagcagctagttgcccgtgccggtaacagcctgatgggcgcggcaggggtcgcatcgctc
ggcgatgatgtatccaatttcatgggcgccatgggggagggtcggctgatcaacttcctg
aatgcggcggatgcggcagaccacgatggcagctgttcgtcgccgatgagcaacaagtcg
gaaaagaacatggccgactttgacgacgaagactcaccgtgcgaggaggagctggcacag
ttggcggcacgtgccgaatcgctgcaccaaggatttcccatctcgagaccgcgctcgatt
ggaacggtggccggcccgtcgccgttacgcgctggcgccgccggaatgggcatgatgaaa
catttgccccatcagcactcgcccggaatgcaccgaatgggggcaaacaatggagcgata
aagatggggaaagggggatccacgaagacgaaagacattctgcaggcaacagcagcggct
gccgcttcggccggtcccgtgggtacgatgatgatcggtacgccctaccgcttccccgat
gtgtgccttccgggcaatacattgctgtgggatctgcttcaggatgataagattggacag
ctgggcgaatcgatcgcactggaggcggagaaagttctcggcacgttgctttgcttccac
acggacaagcacattcgcacgcggttcatcgaaggctgtctgcaaaatctggccgaaaat
cggagcgtggtgacgagcttgaagctgctgcccaagctgtttgcatcgttccagcagttc
cgcgacgtcaccacgcaccaggtggtgctgtggtcggaacggcagcatcgcatgatgttt
catttcttcaacaacttgaaacactacacgtcaacgtttcgaaacagtgcaggcgcagcc
agtgtagtactaccaccgtccgacggcaccggacagtgcggaccgctttattcgcacgta
acccagatccaggtgcggctgcagttcctcacgtccgtctttagtgacgtcggttcgccg
agaagctttcgcctgacgctgaaccaggtggacagcctgtgggcctgtctggccaacgat
ccagagtgcagcgattgtctgttttcctggctgcaggcccaggtgaagggcggcgacacc
catgcgctcggattaaacgcaatacagcatctgtatctgaagcgcctgtcggagctgaaa
ccggaaggcatttcgatggttgcgttgggcctgtttcaacagctgttcaccctcggtcgg
gaggagattttcggccaaccggttgacggtggcgagcgcgatcgtgaaacggacacggtc
ggcatggagcacctgtggaagatagctttgcgggcaaccaacaccgacgtgtcgctgtcg
gccatccagtacatcaacacttactacatggagaagcagctgaagtacgagcaccagttt
gtggcgcagtgtatgaaccatctgtcgcaggcggtcgaggagctgaatcaacattcggac
aacaacgggccggccaccgagtatgcgctgatgtgcgtgcagcgtgcgctgatgctgctc
aacacgcatctcgacacattccggcgacgatacgcgtaccatttgcgtcgctgggccctc
gaaggcaaagacataggggcacacagtgccctgcgcacggagggccccggaccgccgatt
agaattgtgctgcagccggcgggcgtgccggacaaatcgtttctcaacatgcacgcgagc
gatctggtggccgacctgaaggcggaaattgccaagtggtgggaaaagtatcaagctgct
ccgcaggcgaaaacagcccctgccaacaacaccagcactccgggcagtgggggcgagcag
aacagtgcaggtggtggcagtccggccccggtgctcgggctgctgctaaacgatgggccg
ctgagaatcatcacgcagggtcaagagatcacgtccgagtacgatgagcgcagcctggcg
gacgtgggttttaaagataatcagatggtgtacgtgtcgctcggcggacgcagtggccga
aggcgcgagcagagcgaaaatccttccatgcagccaccgcccccgaaggactgtctgccg
acgctgctgctgctaaagccaccgtactttgagcagctgttccgcttgatgcaaacgctg
ggcgacatgaaaatcagcaccacgggagagcgctgccagcccaacaccaaggcacagttg
ctgtcgcgtcgcgtctgggacatactcgcgatgctgcccacgtgcccttcctttttcagc
acgctgaaaaatctgtccttcaaatgtgcagctcggccgaaaacggacgaacagtgcgag
gaggagttgggcgaagcgaagctaccacagcagagaggtgacgaaagtgcggaaggctct
gtcaaggaaacagatcccctactaggtggttgttacacgctggaggaaattcttgatccg
tacaacctgcaaaagttcatgtacgccctgcacattgtggagagcctgtgtaaatcgaag
tttgtgggcaattgttgtggcagcggtgccggtggcgtgatgcacttaaagcaggttccg
ttcaccgagggtggaaataatcgtggcacggtgggagtggccgggacaagctccaaaacg
ctgttggttaagaatcaactaaagctgaagatttcctcttccaagtcgctgaaaatgcaa
caacaaagtggtaccccaaggcaggaaacgtccgttgccgcagcaaccagcaatcgatcg
ccatcgaagggcggcaaacgggtggattttgcacccacctcaccagggccaggtgtagtg
aaaccaacgccattgtgtagtgaggacgaacgctcggccgtactggccaaggacagggcg
gacgagagtgcggaaaataaggaaaacacaccgaactgcgacggggctacgagcaaacca
gaagagcaacgaacaggtgaaacgcagcaagcgattgaatgtgagccagaaggggcgaat
acaggaaacgctcagcaagaccccgtgcaggtggatgaaccgaaaaagtctgagcgcaac
cgagacgcggaagccgatcggaacgaatcctgcgccagttcgtcgcgcgtagtcgagtgg
agcgatgagtttatgcgttgcggtgggttggcccacttgtatcgcatcttcctctccggt
gtgctgcaaaagtctaccgacggatcggacgagagcgaattgaacgagtggcggcacgac
tgtctggcttcgttgctgcgcatcatgtgtctgctgggcatggatgagctgaaggccacc
gaagcggaagggaatgcgattttgataccaccgctaaatcgcgaaacacttgccctgttc
gaaccgcggccaacgctcgagcgcattgcgtcgatcctgaacgaggaatcgcttccggtc
aatcccaacctgttcaagacgggcctgttcggtcggccgcaggtcatacattacgcgatg
aatctgctcgtctgctatgcgcactcgtgcaaggaggtgcgccggctgctctggaccatc
gaggcaaactcgctctggctgcagcgcttgatattggacgatcccgagccggccgtacgg
cgggaggcttgcgctgccctttaccggctctgtctaggcaatgcgcaaacgtactacgag
ctgatggcgccgctactttccaagctggtggcactgttgccgctggcagaaaacatgaaa
ccacaatcgctgaccggtggaccgggcggcggtatctacggcgcgctcctgtcggcggga
gacgaaacaaaggaaccgtacggtccggcttgccgagactacttctggctgctgtgccga
ctggtagacgcactctcgcccgagcttttacggggcaatgctggccactcggcgggcgat
gagctgcagccgcgcgatgcgattggactggacgatatgtgtcagcaggtggcgcgcagc
attctcgagcgcgattatctggagagccggcacggcagccccgacgatggactgttcggg
ctgctcaatctgatggccaacctgctaaagttcgatcccgcgttcaagtacagcctcgtc
gggcaggagttcatgatcagcgtgttctgctgcctgttcgagctgccctcgccggaggac
cgggaaaagccaaagtgtaagagccacgctgcacgggcggcggcctacgatttgctggtg
gagatgtgtcgcaatgcgccgaaaaattatctcctactgcacggcaagttgatgcagcag
caccgtgccggtccgcactcgccgtacccgtgggactactggccgcaggacgagggacgc
tcggagtgtggttacgtcggtttgacgaacctcggcgcgacctgctacatggcgtcgtgc
attcagcatctcttcatgacgccccagacgcgggatgccatcctgtccatctcgaccgac
gcaccgcagaagcataaggctaccctgtgcgagctgcagcgcatgttcgcctacctgatg
gagtcggaacgcaaggcgtactgtccgcgatcgttctgccgggtgtatcagatggaccat
cagccgctgaacacgggcgagcagaaggatatggcagagttcttcatcgatctcgtatcg
aagctggaggagatgacgccggacttgaagaatctggtcaagcgcatcttttgcggtgtc
atcagcaataatgttgtgtccttagactgtgggcatgtgagtagaacgctggaagaattt
tacaccgtccgttgccaggtggcagatatgcgcaatttgcacgaatcgctcgacgaagtt
acggtcaaggatacgctcgagggtgacaacatgtacacctgttcgcagtgcggcaagaag
gtgcgtgccgaaaagcgtgcctgcttcaagaagctaccgcagattttgtgcttcaacacg
atgcgctacacgttcaacatggtcaccatgctgaaggaaaaggtaaacacgcacttttcc
ttcccgatgcggctggacatgtcgggctatgtggagaaaacgctcatgccgcaccactac
caggaggagaagcgaaaatcgcagatgcgccgatcacactcgcgcaacgtaagcgaatcg
tccgccacgggagaagtgaaccctgccggtacgtccgggctggacgataatagtagcagc
agtgccagcagcagcaccagcaccggcttgatgagcacaggcagtgagtgtggcaacggt
ggtaataaaacgaacggccccgcaccggcggtagagaagcagcaagagagcgaagacgtt
gagatgaagaatgctagctcggacgagaaggatggtgccgatgataggaagaatgattca
tcgaacggtaaccttagcgacagcagcaatggagacctgcagcggcagcagcaaacgatg
gacgaggaagagtcggaagacttcaatgagcactacgagtacgatcttgtcggcgtaacg
gttcacacaggcaatgcggacggtgggcattactacagctttatcaaggagcgcaacgag
gacggcgatccgaaccaccaggaacgctggttcctcttcaacgatgccgaagtgaagctg
ttcgatccaacgcaaattgcggctgaatgttttggtggagaaatgacgagtaaaacgtac
gactcggtggcggaaaaatacttggattttagcttcgagaaaacgaactccgcgtacatg
ctgttctacgaatggcgttcgaacaagggcaaaaacgtgcagcgtgaccaggcagaagaa
cagcaagccacgaacagcgccacgtctgcaccttcggcagagaaacgatcctctactgca
tcaaacagcagtgtcgatagcgataaaagaactttaaataatgcaactactggcagttcc
ggacgatctcccactaaaaccccgatcaaatccgctggcgtgtcggaaaggggaagttcc
agcaagcagcaagacccaacgccagagcttacggacggtggccatttctcgaacagaaaa
gccaccatgccgtcccaaagttcttccttcagttcgactccattttccatggcgcaagcg
tcgttttcggcggcctcgcctctgccagcgtcgactgcagctactagtggtggaccctct
tttaaagtggcaccgaataccaatagcaaagctgccctagcccaagacccgttgccatcg
aacctggggccatcgaaggattgtcatcagcctgtctatgctacagcagtgggtcaaggt
ccggcatcagcaagaaacgaacgtgatcaagagactgaacaattcatccaacaacctagt
gaagtagctaaacaaagtaataatctaagtaaatgtgatatagatactaagcacgctagc
actgctagaataccatcaacgacatcatcacagcagcagcagcagcagcaggaagttgag
gtgacatccaccagagtggtcagcccgacgccaacgaccgcatcccttgccagcactgct
tcactgtcgccaacgtcaaccgcgtcgaccgcttccgttgcttcagcgggagccgctccc
acagcgattacagttcccaccactgtgccaagtgctcaaagtgtaccgtcgtcggtgtcc
gcgtccacgcccttacacccggtaatcgtgccaccgttggcaggatcatccatctcgacg
gcgccggtatcgtcctgcttgggtgtgctgggtggaccagggccagcagcagtagcagcc
tcatcggtcatcggtttccagggatcgacatcgtctgcaacgtcaccgtcagccatgcta
catggcgtcgttccggaaccggcaccatcctcgtactcatcgatatcatccctatcggct
ctgacggccaccgtggggggtaacatcgcgctgcctatggcagccgtcgtcggaccaacg
cctggtgggcctggatcgtccttcagcgccgttgcaacacacgccgtactgcaggcttca
agctcgcccggttgttccagcagttcgggcagcggaagttccggtagttcggggctggta
atggtgaatcggatcaaccactcgagcaaacgtctccgccgccggcccctatctaaggag
ctagaggagtggatatggcaggataatcggcacttcctgcaggaccgcaacatcttcgag
cacacgtactttaactttatgtggcaaatttgtggccagataccgcaaaatctgctggcg
ctaccggatataacgtgcatcgcggctcaactgtcagtgtcgttttttatcgaaacattt
atacacgcaaaggaaaagccaacgatggtgttatgggtagagttactaacaaaacagttc
aacgccagccaggaagcgtgcgaatggtttcttagccatatgtcggccgaaccttggtgg
cctgtacaggtgctaatacaatgtccaaatcagatggttcgtcagatgttccagcgacta
gtgatacatgtaatacagcgtttaagacaaagtcactgcagtctgtatctgaaggcagaa
accgacctagacggaaatgaaataatcggcaatgtgtcgtgtgtgacgcgcttcatcaaa
tcgctcatcatgttgatggagcacggtgcaaaagcacattcgcgacatctgtccgagttc
ttcggcttgctgtacgagttttctcgaatgggcgaagaggaggcattgtttttgctgcgc
attaacgtgatacgaagtgtggccgatttctacctcggtcacaaagggcaggaatgcatg
gacgccaattcggacaatgaggaaaattcttcggacgaagctctaacggtggacaaatcg
cggccggcctcgttggacaaaatgattgcactagtggcatcgctagtggaacggtccaga
ggaccggatctgcggctgcatctttccgcccgcgactacaatgcgatcgccggtggtaaa
ggattcccgttcttgtatcagcaaatcaaggacaacatcaacccgcagcagacgcgccat
ctaatccacgcactgtgtagatgtgacgagcggctcgctagccaaatcatagccatgctg
ttcaccgccgtcacgaagcacacggagctgtgtgggccatttttcaagcttattaccctg
ctcacggaatcttcgggcggtccgtcggggctaccgtgcttctcgcagctcgtcctgcag
cgtgtctgggatgcggccgagtactgtccgcagtcggccctggactggctggccgtgcag
gcgccacgcaacaagatcgtccacaactggatcctccagtcggccgacagctgggtggag
cggttcctgctggcacacggaaacgcacgggtccggaatgctgccgcttatctgctggta
tctctagtgccttcgcaaagcttccgcaacaactatcgagcgacatcgcaccacaagcta
tcgatgcacgtgtttcagcatcgcgaaatctcctgcgaagcccagcttattctgcacact
atactgaacatgctgctgctcctgcttcgttcggcgcgcaactacaccgacattaacgtg
cacggcacgagcaagtttaccgcgtattttaatcttctaacttactgtttggtatccaag
acggagaagcttatggttggaccacacttgagggcgctgtgggacctatttcacccgaga
ctgtcggaaccggctgtaccggcacatcacaataagcaagcgttgcttgcgttctggtat
caggccacacttgactgtccagaaaatgcgaacctcgtagcaaactgtccagacataacg
aggaacattgcatttaactacattttagctgaccatgacgatacggaaatagtgacttac
aaccgtgcaatgttaccagtgtactatggtttgctgcgaatgtgctgccagcaaagccgc
ctgctaacccgacagctagccgctcaccagaacctgcaatgggcgttcaaaaacatcacg
ccacatccgacccaatacccgttagccgtcgacgagctcttccggctgatgacgctgttt
gcccagcgacacccagaagcgagcgaggccgaacagcgcgacgtgaccatcttccggcgg
acgacccttactgcctacctgaatggactggatgcgcgggtgtcctggggtacgctaata
gcggcgctgcgcattctcgtagacaacgatgacgaccgcctgtacgtggtgctgaacggc
ggcataacgctttgcttcgacgcgctgcacacgctgcactcgatgtaccacgaggccacg
gcgtgccacgtgtacggcgatctgcaggaactgctgacggaggtaatactgctgatcaat
accctgcgggcaagtagccgcgagcagaagaagcgcccgcagccggccttgatgaaggga
ctgccggatgccgtccggcgattggcaacgctgctgaacacattcaatccacccgagatg
cgtaacctggcgctggaggtgctgaaggagctggttaagtgtgctccgccggacatcatt
acgacggtgctggtaccgctgctaacgagctgccatgcaccgcacgtgcatcacctaatt
catcaggcaaacagtgccggaagcggtagcgcggcggcgacggccaatgcagccgctgca
tcagctgcagcagccgctgcatcagctgcagcagccgctgctgcctcgtccatcgggccg
ctcggttcgtactttccgcggcgtggaatgaaagccgcctggccaccggtgtcaaaaaat
acgccccgtccaccgaaagcaatggtgcagatgaacattccacagtcacagatttgtgaa
aagggtttggacaaggattttgatcttgcacttgaactgttctatcgaccgtaccacgaa
tttctggacataatgttccgcgtggcggttacatcgaaccactttacggaaccattggta
cacctgtcgctgttgaccggaatcgaaggcgtagtgctgcactttaacatctttgcaaag
ttttgggttgggatctataacaacaaaacaacacaccgatatgctgatatgctcatcaag
aatccactgctcattgattacatcgacaacatactgagagacgaaagactttcgctcaat
gatcccattatagcgaattttatcgaaatctactatccaaagataaaatctcgtcttgtg
gtgccacgcctgttggaatccatctgtcagctgctgccggacaagaacaacttggaggat
atatgcggcgatctgcaggcgatacgcattattggccagcgcacgggaattccaagctct
gtcaagggtgcgctacagaactcgctgcatgccgtgctaacgaaattcaaggatgaaatc
tacagtgacgaagaagtaccaacgaaaaagcggaaagttacagtgccacacataacgata
catccggttgtgcgatcaccatcctccggtgggaatgtgtctgccgcccaagtgctaccg
gagacgggacattccgcagcaggtgcagcggcggcaagcgtatccgagacgacgttggct
aaagctacgcggctaaaggaaaccataccaccctcgattgaaataacggtacaaaataaa
cccaccccttccgtgggtgctgcagttggtgctggcggtggcgtgataaaacagccaatc
ggagcagaaagcccaagctcctcgaatgaggcacgaaatcaaccgacctcgtcgaagaac
ccagcccccgaggcggctgcagcggtttctgaagcaacgcgaccaatacagccgtcgtca
cctagtagtggggaaaaggaagcagaaaaggccggtgaacagtcagcgggtgagaatgat
atcatcggacccacggcattagacgccggtaccaccagtgagcagaacctgaaccagcaa
cagcagcaaaagcaacaggaacagtacctgcgtaatttggtgaaagacattgagagccat
attgagctaatatttgagtgtttggacgatgacgagggtgagaatgcgaacgataccaac
aatgctaagtcccatcaccaccagccgcagcacgatgaaacggtcgaacggcagccagaa
acgagtggaaaagtactacccgaaaaccatgcaaccagcaacaacccgcccactaagccc
gagtccagccccaccgccgtatccatgggagcagctatgtcgacttccagcgctgcagaa
ggtatggagcaaggtgacgatctcacagtagctagcagtagcagcaccagtgctggctgt
caaaccgcagtcgatgaaacactgacagcagctgaagaattagccgcgcggcgtaagtta
ggcgataatggcgacactggacggcagtcaccagctggtagtaagttgcaaaagaaacca
atcgaatcgcaggaaccgcagggaattggtgtaaccaacagtagtagtagcggtgagggt
ggttttgtgatggctggaacacaaccactgttagacacgcaggacactaactcccaggta
ggtccagaaacgtcaggtaaggaaaatacttcatccacatcggatacaattgaggattga

DBGET integrated database retrieval system