KEGG   Anopheles gambiae (mosquito): AgaP_AGAP003704Help
Entry
AgaP_AGAP003704   CDS       T01036                                 

Definition
AGAP003704-PA
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aga00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AgaP_AGAP003704
Enzymes [BR:aga01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     AgaP_AGAP003704
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2R
AA seq 478 aa AA seqDB search
MTAILGAGISGLAAGHYLLRKTPTLPLTIYEATDRIGGWIRSERSPDHGYVFEAGPRTIR
PKGPAASNTLELIEELGLTDQVYSISSNHTAARNRMIYAKGKLNLLPNSLGGVLKTVPPF
TRPLYFAAFHDLLAGRSKTPLTDESMYSFVERRFGKEIADYAVSSMLCGICAGDAKQISV
KFLMKDLFEREQRHGGVIVGLLKEALQNRKKKQPKSVKKPATQMARLADRAKAENWSIYS
IRGGLQTLPETLATDLQAKGASIVTGTKFEELTFDGDRVVLRVDGKEQLLQHLVSSIPSY
KLAKHVQKQHPQLASTLSSIPFVDVCVINLRYRRGDLLQQDGFGFLVPPIENLPILGVIF
DSCCFDMDDNTVLTVMMGGAWFEQWFGKNPSDEHLLGVALEHIKKILHIEQQPDSYKVNL
LRKCIPQYTVGHQDRVKAIRAYVEQHRLPLSLCGASYDGVGVNDVILSARKNVETIQQ
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgactgccatcctcggcgccggtatcagtggactggcggcaggccattacttgctcagg
aaaacaccgactctacctcttaccatttacgaagcgacggatcgtatcggtggttggatt
cgttctgaacgcagcccagaccatggatacgtgtttgaagccggaccgcgcaccattcgt
cctaagggcccggcggcaagtaacacgctcgagctgatagaagaacttggccttaccgat
caggtgtactccattagctccaaccatacggcggcccggaatcgtatgatttacgcgaag
ggcaaattgaatctgcttcccaactcactcggaggcgtgctgaaaacggtgccgcccttc
acgagacctctgtactttgccgcctttcacgatctgctggccggccgatccaaaactccg
ctgaccgatgaatctatgtactcgttcgtggaacgaaggttcggcaaggagattgcggac
tacgcggtcagctcgatgctgtgcggcatttgtgccggggacgctaaacagatcagcgtt
aaatttctcatgaaagatcttttcgagcgcgaacagcgccatggcggtgtaattgtaggg
ctgctcaaggaggcacttcagaatcggaaaaagaaacaaccgaagagcgttaaaaagcct
gccacccagatggcacggttggccgacagggcaaaggcggagaattggagcatctattcg
atccgtggcggtttgcagacgttgccggaaacgttggccaccgatctgcaggcgaagggc
gcatcgatcgtaacgggcaccaagttcgaagagcttaccttcgacggagaccgggtggtg
ctgcgggtcgatgggaaggagcagctgctgcagcatctcgttagcagcatcccgagctac
aagctggcaaagcacgtccagaagcaacacccccagctggccagcacgctgagcagcatc
ccgtttgtggacgtgtgcgtgatcaatctgcggtaccggaggggcgatttgttgcagcaa
gatggcttcggctttctggtgcctccgattgaaaacctaccgatactgggtgtcattttc
gacagctgctgcttcgatatggacgacaacacggtgctgactgtgatgatgggaggagcg
tggttcgagcagtggttcgggaaaaatccgtccgacgagcatttgctcggggtcgcactc
gagcacattaagaagatcctgcacattgagcagcagcccgacagctacaaggtaaacttg
ctacgcaaatgcattccccagtacaccgttggccatcaggatcgggtgaaggccatccgg
gcgtatgtagagcagcatcggcttccgctgtcgctgtgcggtgcttcgtacgacggtgtc
ggcgtgaacgacgttatactatctgctaggaagaatgttgagacgatacaacaataa

DBGET integrated database retrieval system