KEGG   Anopheles gambiae (mosquito): AgaP_AGAP003833Help
Entry
AgaP_AGAP003833   CDS       T01036                                 

Definition
AGAP003833-PA
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aga00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AgaP_AGAP003833
Enzymes [BR:aga01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     AgaP_AGAP003833
Peptidases [BR:aga01002]
 Cysteine Peptidases
  Family C44
   AgaP_AGAP003833
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2R
AA seq 578 aa AA seqDB search
MCGILCIFTQYTSTDTSPQNRTSCNGESSQCGDLSCDSLREMAFRQSSKQRHRGPDQTGL
CVNDEYGFVLVQERLSIVGVKTGRQPLTSTNGMTHLVANGEIYNFLHMASLINDALKFEY
YTPRSDCDVLVAFYELFGADRLLQIVRGMFAFVLYDCSTHRLLVARDPVGIVPLYYGWDD
AGSLWFASELKCLVGCCPEVNVFPPGHSYYGLRESFVPKPYFQALWMTEISTARVDLELL
KHHLESAVESHLQSEVPFGALLSGGLDSSLIASIATRILRARTDNSTFRLKTYSIGLEGE
SPDLTYARMVADYIGSDHTEVRFTIPEGIDLVRDAVYYAETYDVTTIRCIVAVMLLARAI
RSEGIKVVLSGEGADELFGGYLYFHRAPSAAEFHRETVRRVRGLHLSDCLRANKGCAAWG
LELRVPFLDTDFLQHVMSIRPEDRAPGIPSHDDHSALEKRILRQAFADGNYLPSEVLWRQ
KEQFSDGVGYAWIDAIAQWASKRVTQTEYAAAADRFPFNTPTTKEAFYYRKLFEQMFPGE
SFARTVQRWIPRTDWGCSEDPSGRKQDVHRGHNRREQE
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtattctttgtatatttacgcaatatacatcaacagacacaagcccacaaaat
cgcacaagttgcaatggagagtcctcacagtgtggtgatctttcgtgtgattccttacgg
gaaatggcctttcggcaatcgagtaaacagcggcaccgaggtcccgatcaaactggcctg
tgcgttaatgacgagtatggattcgtgctggtacaggagcgcctttcgattgttggagtg
aaaacaggacggcagcccctaacctcaaccaacggcatgacgcatctggtagcgaacgga
gagatttacaactttcttcatatggcgtcgcttattaacgatgcgctgaaatttgaatac
tacacaccgcgcagtgattgtgacgttctggtagctttctacgagctgtttggagcagat
cgattattgcaaattgttcgcggcatgttcgctttcgtgctgtacgactgcagcacccat
cggctgctggtagctcgtgatccggtcggcatagtgccactttactatggttgggatgac
gcagggagtttgtggtttgccagtgagttaaagtgtctagtgggttgctgtcccgaagta
aatgtgttccctcccggccattcatactatgggctaagggagagttttgtcccgaaacct
tactttcaagcactatggatgacggaaatttctaccgctagagtcgacctggaactgttg
aaacaccacctggaaagcgccgttgagtcacatttgcagagtgaggtgccgttcggtgct
ctgcttagtggtggactcgactctagcctgatcgcctccatcgccacacgcatacttcgc
gcacgcacagataattcaacctttcgactaaagacatacagcattgggctggagggagaa
agtcctgatctaacgtatgcacgcatggtggctgactacatcggcagtgatcacaccgag
gtccgttttaccatcccggagggcatagacctcgtacgggacgctgtgtactatgccgag
acttacgacgtcactacgatccgctgcatcgtagcggtaatgctgctggcaagagccatc
cgcagcgaaggcattaaggtggtgctctcgggcgagggggcagatgagctattcggcggc
tatctttattttcatcgtgccccgagtgcggccgagtttcatcgtgaaacggtgcgccgc
gtacgaggacttcatctgtccgattgtttgcgtgccaacaaaggctgtgcggcctgggga
ctggagttaagagttccgtttctcgataccgatttcttgcagcacgtaatgtccatcagg
ccggaggacagggcgcccggcattccgtcgcacgatgatcacagtgcgctggaaaaacgt
attcttcgacaagcgttcgccgatggtaattaccttccgtcggaagtgctctggagacag
aaggagcagttttccgatggagttggatatgcctggatcgatgccattgcccagtgggca
tcgaagcgtgtcactcagacggagtatgcagctgccgccgatagatttcccttcaacacg
ccgacaacgaaagaagcgttctactatcggaagctattcgagcaaatgttcccgggggaa
agctttgcacgtacggtgcaacggtggattccacgcacggattggggttgctcggaagat
ccgtccggtagaaagcaagacgttcatcgaggtcataataggcgagaacaggaatag

DBGET integrated database retrieval system