KEGG   Anopheles gambiae (mosquito): AgaP_AGAP003983Help
Entry
AgaP_AGAP003983   CDS       T01036                                 

Definition
AGAP003983-PA
Orthology
K14316  
nuclear pore complex protein Nup121
Organism
aga  Anopheles gambiae (mosquito)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:aga00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    AgaP_AGAP003983
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2R
AA seq 1662 aa AA seqDB search
MKQPEAASAALKSGLLSSPSSSSRNNQSTSSRMSSFGGSATGLSRTLSTPPVAESTHIGG
TSFSAAWNGASLGGQSKRRPTSPLMSNSRTLFKSSGNLTGIGRVNSRVITDARSPGLVNR
LVRYYDRGQSQAAINRSQSLSSVYNKPGQFPLVQLRKQELRYTNSSTARRNGNFSMVRIA
PPERSLFQTNKRSSIFRSGSMFLPTTNESANESSLFAGLGTPRNGPSGSGSGSGSGGSGG
GGGGDVADAENRVITPCAELDSTPTRSVLDALKEISRKRINSEELDADRIKKQCQELSEL
DAAGSGPPSSTAAVAIGTHGLATKRSREQAMESSPASPSELGPPGLGGVGRAPHSGGEQQ
TQKKRLCVKNNDILSSLSSSLVAMNTPKRNVVPRNDRRLYMNHSISMSSPAIGTIPTSSS
TLVGLATPEKFSNMALNSPGPLERSDSPKDTATNGHAQQSVARTSTTLDHHWNQSGRGSA
SKEPMEQLLPPHRAPPKITLFNRPYESAAMTGVADKSGSPSARGTQSRHASRLLSSDGED
DEHGEGSGKVQFVKPKEKSPNDVTLSGLGSGGFSSSRDPLKKPAPSKLTVMLKCLSGDLD
DYEEEQEEQQSRQPSRATATAPQSRNGFSFGSNAPAKDTVDGPKELPASGPSKQPATTTL
KDSAASTPVSAASSSTPVTNGGLSALINNPIKDTGLGKIAVPTSKETVVAVPAAQTSAAN
EAKTASAPSEAAKTLTFSFGSNSGTTSVSSPPPVATTTTTSTGFSLSAKPLATTSTAAGQ
SSTATPTFSFGTPASPKTTGAAQTTSSPIATSLGMSNLIAFSPAPGTLGSTFGSGSGAAK
LPSPVLQFGSPATTSTVTTTATPGSTSTFSFTAGAATMPTAANTPAMPAASISSPTTFGS
PGSFGGFKLPPASTQAGSTGATTSTVTTTQSATPAFSFGANAATASSSTTTTTIPVFGSS
SSLFTNATSSAPSTAGTNGATMTSGSTFTFGAPKSTPSAPAPSFTFGATALAPTAQASSA
PAAASTNAFSSSVAPSTTTFPTFGSIAGAGGGAGATTGTAAATASANPTNPSQPTFTFGG
AKPASATTPNLFGAAAPSSNSTTSASSDAGKTNLFASATTQQANASNIFGAAAAGSQVAP
AAPPTGGTSVFGVANGAVPGAASSPFTFGAAKPAAAPAPTSGNANSNNNNNSSGTTGSIF
GNAVASITSPAGQAATPGMFTFGSAKAPAPGAQGVQNTATSNQQQPQASNPLGGGGVPTF
GATATSNTNASPFAFGANKAPAGGGIFGGITATNNNNNSTTGNSNTSTPSAVPAFGATMN
GANPAPAFGTTGSIFGSANATGASTGSANQSVGSIFGTPQTNGPQNVNNTAASTGQPGGL
FTFGASNTANSAPNNATPTFGSNAGSGSTFGGFNATPAAGTMSNGIGGNTTAPANKPFTF
GASSAGPMVPQNNAQQQQQQQQQQAAPSQSGAFNFNLGSNAAPKPFNFTGGLGNANANVA
SPPMFGSPVATGNANPAPNNASPFAFGAMVNGANAAPAPNSNATAGPFTFGAPAAQPAPG
PAFNFSAGNVAAVAPQPQQQPGAAFTFGGAQQQQPQQQQQQQQQQQQPFGMGGGAAPFGA
PPAFGAPGGIVPGGVMPTFSIGTNSTPNGPPRRIKVATRRVK
NT seq 4989 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagccggaggcggcgagcgctgcgctgaaatcgggcttgctgtcatcgccctcg
agcagctccaggaacaaccaaagcacgtcgtcaaggatgagctcctttgggggcagtgcg
acgggtttgagtcgcacgctcagcacaccgccagtcgcggaatcgacgcacatcggcggc
acgagcttcagtgctgcctggaacggtgccagtctcggtggacagtctaagcggaggccc
acctcgccgctgatgagcaacagccgtacactgttcaaaagcagcggtaacctgacgggc
attgggcgtgtaaattcacgagtgataactgacgccagaagcccgggtctggtgaatcga
ttggtgcgttactacgatcgcggccagtcccaggcagccataaaccgctcccaatcgctg
tcgagcgtgtacaacaaaccgggccagtttccgctggtgcagctgcgcaagcaggaactg
cgttacaccaacagcagcacggctcggcggaacgggaacttcagcatggtgcgtatagcg
ccgccggagcgatcgctctttcagacgaacaagcgcagcagcatttttcgcagcggttca
atgttcctgccgaccacgaacgaatcggcgaacgagtcgtctttgtttgcggggctgggc
acaccacgcaacggacccagcggcagtggcagcgggagcgggagtggtggcagtggaggt
ggtggtggtggtgatgttgcggacgccgaaaaccgcgtcatcacaccgtgtgccgagctg
gattcgacgccgacccgtagtgtgctcgacgcgctgaaggaaatttctcgaaagcgtatc
aacagcgaggagctggacgcggatcgcatcaagaaacagtgccaggagctgtcggagctg
gatgcggccggcagcggcccgccgtcatcaacggcggccgttgccatcggaacacacggc
ctggcgacgaagcgaagccgcgaacaggcaatggagagcagccccgcctcgccgtcggag
ctgggaccgcccgggctgggtggagtgggccgtgcgccccattccggcggcgagcagcag
acgcaaaagaaacggctttgcgtgaagaacaacgacattctcagctcgctcagctccagc
ctggtcgcaatgaacacaccgaagcgtaatgtagtaccgcgcaacgatcgtcgcctgtac
atgaaccactcgatcagcatgtccagtccggcgatcggcaccataccgacctcatcctcg
accctggtcggactggccacgccagaaaagttctccaacatggcactgaattcacccgga
ccgctcgagcgaagcgacagtccgaaagatacagcaaccaacggtcacgcccagcagtcg
gtggcacgcaccagcacgacactggaccaccactggaaccaatcgggcaggggtagcgct
agcaaggagccaatggagcagcttcttccaccacaccgtgccccaccaaagataacgctc
ttcaaccgaccgtacgaatcggcggcgatgacgggagtggcagataaatccggctcgcca
tcggccaggggcacccagtcaaggcacgccagccggctgctgtcgagcgatggcgaagat
gacgagcacggcgagggcagtgggaaggttcagttcgtaaagccgaaggagaaatcgccc
aacgatgttaccctgtccgggttaggctcgggcggatttagttcgtcgcgcgatccgctg
aagaaaccggccccatccaagctgacggtgatgctgaagtgcttgagcggagatctggac
gactacgaggaagagcaggaggagcaacaatcacgtcaaccttcgcgagcgactgcgact
gcgccacagtcgagaaatggatttagcttcggttccaacgcacccgcaaaagataccgtt
gacggaccgaaggaacttccagcgagtggcccttcgaagcaaccggcgaccactacgttg
aaggattcagcggcatccacgcccgtgagtgctgcctcctcttccacgcccgtcacgaac
gggggactgtcggcgttgattaacaaccccatcaaagataccgggctgggcaagatcgct
gtaccaacatcaaaggagactgttgttgccgttcccgctgcacaaacgtccgcagcgaat
gaagcgaagacggcgagcgctccatccgaggcggcgaaaacgcttacgttctcgttcgga
tccaacagtggcacaacttctgtcagcagccctccgccggtagcgactacaacaacaacg
agcactggattttccttgtcggccaaaccactggcaacaacatcgaccgcggcaggacaa
agcagcacagcgacgccaaccttttcgttcggaacaccggcctccccgaagaccacaggc
gcagcgcaaacaactagcagcccgatcgccactagcctgggaatgtcgaatttgatcgct
ttctcgccggcaccgggcacgctggggtccacattcggtagcggtagcggcgctgccaag
cttccctcaccagtactgcagttcggaagtccggcaacaacgtccacggtcaccaccaca
gctacacccggcagcacatcgacgttttcgtttacggctggagctgccacaatgccgacc
gccgctaatactccagcgatgccagcagccagcatcagctcgcctaccaccttcggtagc
cctggttcgtttggaggattcaaacttccccccgcatcaacgcaggctggcagcactggc
gccacaaccagcacggtgaccacgacgcaatcggccacgcctgccttcagcttcggtgcc
aacgcagctaccgctagcagcagcaccaccaccacgacaatcccagtgtttggttccagc
tcgtcgctattcactaacgcgacctccagtgcgccgagcactgctggaaccaatggagct
acgatgactagcggcagtacatttacctttggcgcaccgaaatcgacaccatcggcgccg
gccccttcgtttacgttcggtgcgacagcactggccccaacagcacaggcaagctcagcg
ccggcagccgccagtacgaatgctttctcctcttccgttgcaccgagcacgacgacattc
ccaacgtttggttcgattgccggggcaggcggcggagcgggagcaacgacagggacggca
gctgccacagccagcgccaaccctaccaacccgtcccaaccgacgttcacattcggcggg
gcaaagccggcatccgcgaccacaccgaacctgttcggtgcagccgcgccttcgtccaac
tccaccaccagcgcatcgtccgacgcaggcaaaacaaatctctttgcttccgcaacaacg
caacaagcgaacgcttctaacatattcggtgcggccgctgccgggagtcaagtcgcgcca
gcagcacccccgactggtggaacgtcggtgtttggtgttgccaacggagctgtaccgggt
gcggcttcatctccgtttacctttggtgcagccaagccagcagcagccccggccccgact
agtggcaatgctaatagcaacaacaacaacaatagcagcggtacaacaggttccatcttc
ggcaatgcggttgcatccatcacatccccagcaggccaagctgcaacgcccggtatgttc
acgttcggttccgccaaagctcccgctccaggcgcacagggtgtacaaaatacggccacc
tcaaaccagcagcaacctcaggcttcgaatccgctcggtggtggtggcgttcccacgttc
ggtgcgaccgctaccagcaatacaaacgcgagcccctttgcgttcggtgcaaacaaggcg
cccgcagggggtggaattttcggtggcattacggcaacaaacaacaacaacaacagcact
actggaaattccaacacatccaccccgtcggcggtgcccgcgtttggtgccaccatgaac
ggtgccaatccggcgccggctttcggcaccaccggatccatcttcggcagcgcaaatgcg
acgggagcttctacgggctcagcgaaccaatcggtgggctccatctttggcacgccacaa
acgaacggaccgcagaatgtgaacaacacagcagcgtccaccggtcaaccgggtggattg
tttacgttcggagcaagcaatactgctaacagtgctccaaacaatgccacccccacgttc
ggaagcaatgcgggcagcggcagtaccttcggtggcttcaacgctacgcccgcggcagga
accatgtcgaatggcattggcggcaacacgacagcacccgccaacaaaccgttcacgttc
ggtgcgagcagtgccggcccgatggtgccacagaacaacgcccagcagcaacagcagcag
cagcagcaacaggcagctccttcccaatctggcgctttcaatttcaacctcggatcgaac
gccgcaccaaagccgttcaatttcactggcgggcttggcaatgcgaacgcgaatgtggcc
tcgccgcccatgtttggttcaccggtcgcaacgggtaacgccaatccggcacctaacaac
gcgtctccgttcgcgttcggcgcgatggtcaatggagcaaacgcagcccctgccccgaac
agcaacgcgaccgccggtccgtttacgttcggtgccccggccgcccagcctgctccgggt
cctgcgtttaacttctccgctggaaacgtcgcggcagtcgcgccacaaccgcagcagcaa
ccgggggcagcatttaccttcggtggagcgcaacagcagcagccccagcagcagcagcag
cagcagcaacagcagcagcagccgttcggcatgggcggtggcgcggcaccattcggtgca
ccacccgcgttcggtgctccgggcggcatcgtgcccggtggcgtcatgccaacgttcagc
atcggcaccaactcaaccccgaacggaccgccgcggcggataaaggtggccacgaggcgt
gtcaagtga

DBGET integrated database retrieval system