KEGG   Anopheles gambiae (mosquito): AgaP_AGAP004055Help
Entry
AgaP_AGAP004055   CDS       T01036                                 

Definition
AGAP004055-PB
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:aga00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AgaP_AGAP004055
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AgaP_AGAP004055
  Amino acid metabolism
   00310 Lysine degradation
    AgaP_AGAP004055
Enzymes [BR:aga01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     AgaP_AGAP004055
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2R
AA seq 493 aa AA seqDB search
MAGILSISSRNLPRAALRLGLRSLEGQSGPQQGTVTGSRSYHQGRRLLPSVAVRSAVTDS
GRRCESVRNSIKAQGWAVNERAIFTSARMLSSEIVKVPPFADSVSEGDVKFEKKVGDAVA
ADEVVMEIETDKTTVGVPAPGHGIIEEIYVADGDTVKAGQQLFKLKITGEAPKASAAKPA
EAPAPAAAAPPPPPPPPPVAAAAPPPPPPAAAAGTPPPPPPPKPAAPISRMPVAAIRHAQ
AIEAATVKVPPADYTKEITGTRTEQRVKMTRMRLKIASRLKEAQNTNAMLTTFNEIDMSF
IMDFRKQHLEAFQKKYGMKLGFMSAFCKAAAYALQDQPVVNAVIDENEIIYRDYVDISVA
VASPKGLVVPVLRNVEGMNYADIELAIAGLADKAKKGTLAVEDMDGGTFTISNGGVFGSL
LGTPIINPPQSAILGMHGIFERPIAVKGQVVIRPMMYVALTYDHRLIDGREAVTFLRKVK
AAVEDPRIVLAGL
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggccggaatactttcgatatcgtcgcgaaatttgccccgcgcagccctccgtctcggt
ctgcgttcattggaaggccaatcaggaccccagcagggcactgtaaccggttcgcgatcc
taccaccaggggcgtcgattgttgccgagcgtcgccgtccggtccgcggtcaccgacagt
ggcagacgttgcgaatccgttcgaaactctatcaaggcacagggatgggctgtgaacgag
cgggccatcttcacctcggcccgcatgctgtcgtcggaaatcgtgaaggtgcctccgttt
gccgattccgtgtccgagggcgatgtgaagtttgagaagaaagtcggcgatgcggtggcc
gccgacgaggtggtgatggagattgaaaccgacaagactaccgtcggtgtcccggccccg
ggtcatggtattatcgaggagatctacgtcgcggacggcgatacggtgaaggcgggtcag
cagctgttcaagctgaagattaccggcgaagcgccaaaggccagcgccgccaagccggcc
gaagctccggcaccggcagcagctgccccaccaccaccaccgccgccaccaccggtagcg
gctgccgctccgccaccgccaccaccagcggccgccgcaggtacgcctccgccaccacca
ccgccgaaaccggcggcaccgattagccgaatgccggttgcagcgatccgccatgcgcag
gccatcgaggcggccaccgtgaaggtaccgccagctgattacacgaaggaaatcaccgga
acgcgcacggagcagcgcgtcaagatgacgcgcatgcggctgaagattgcctcgcgccta
aaggaagcgcaaaacacgaacgcaatgctgacgacgttcaacgaaatcgacatgagcttc
atcatggatttccgtaagcaacatttggaagcgttccaaaagaagtacggcatgaagctg
ggcttcatgtctgccttctgcaaagcagctgcctatgccctgcaggaccaacccgtcgtg
aatgctgtcattgacgaaaacgaaattatctatcgtgattacgtagacatttcggtagcc
gtagcgtcgccgaagggtctggtagtacccgtgctgagaaatgtggaaggtatgaactac
gccgatatcgagctggccatcgctggactggcggataaggcgaaaaaggggacgttggcc
gtagaggacatggatggtggcacctttaccatctcgaacggtggagtgttcggatcgctg
ctcggcacgcccatcatcaatcctccgcagagcgccattcttggcatgcacggcatcttc
gagcgaccgatcgctgtgaagggacaggtggtaatccgacccatgatgtacgtagccctg
acctacgaccatcggttgattgatggccgtgaggctgtcaccttcctgcgcaaggtgaag
gccgctgtcgaggatcctcgcatcgtgctggccggtctgtaa

DBGET integrated database retrieval system