KEGG   Anopheles gambiae (mosquito): AgaP_AGAP004055Help
Entry
AgaP_AGAP004055   CDS       T01036                                 

Definition
(RefSeq) AGAP004055-PB
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:aga00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AgaP_AGAP004055
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AgaP_AGAP004055
  Amino acid metabolism
   00310 Lysine degradation
    AgaP_AGAP004055
Enzymes [BR:aga01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     AgaP_AGAP004055
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2R
AA seq 493 aa AA seqDB search
MAGILSISSRNLPRAALRLGLRSLEGQSGPQQGTVTGSRSYHQGRRLLPSVAVRSAVTDS
GRRCESVRNSIKAQGWAVNERAIFTSARMLSSEIVKVPPFADSVSEGDVKFEKKVGDAVA
ADEVVMEIETDKTTVGVPAPGHGIIEEIYVADGDTVKAGQQLFKLKITGEAPKASAAKPA
EAPAPAAAAPPPPPPPPPVAAAAPPPPPPAAAAGTPPPPPPPKPAAPISRMPVAAIRHAQ
AIEAATVKVPPADYTKEITGTRTEQRVKMTRMRLKIASRLKEAQNTNAMLTTFNEIDMSF
IMDFRKQHLEAFQKKYGMKLGFMSAFCKAAAYALQDQPVVNAVIDENEIIYRDYVDISVA
VASPKGLVVPVLRNVEGMNYADIELAIAGLADKAKKGTLAVEDMDGGTFTISNGGVFGSL
LGTPIINPPQSAILGMHGIFERPIAVKGQVVIRPMMYVALTYDHRLIDGREAVTFLRKVK
AAVEDPRIVLAGL
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggccggaatactttcgatatcgtcgcgaaatttgccccgcgcagccctccgtctcggt
ctgcgttcattggaaggccaatcaggaccccagcagggcactgtaaccggttcgcgatcc
taccaccaggggcgtcgattgttgccgagcgtcgccgtccggtccgcggtcaccgacagt
ggcagacgttgcgaatccgttcgaaactctatcaaggcacagggatgggctgtgaacgag
cgggccatcttcacctcggcccgcatgctgtcgtcggaaatcgtgaaggtgcctccgttt
gccgattccgtgtccgagggcgatgtgaagtttgagaagaaagtcggcgatgcggtggcc
gccgacgaggtggtgatggagattgaaaccgacaagactaccgtcggtgtcccggccccg
ggtcatggtattatcgaggagatctacgtcgcggacggcgatacggtgaaggcgggtcag
cagctgttcaagctgaagattaccggcgaagcgccaaaggccagcgccgccaagccggcc
gaagctccggcaccggcagcagctgccccaccaccaccaccgccgccaccaccggtagcg
gctgccgctccgccaccgccaccaccagcggccgccgcaggtacgcctccgccaccacca
ccgccgaaaccggcggcaccgattagccgaatgccggttgcagcgatccgccatgcgcag
gccatcgaggcggccaccgtgaaggtaccgccagctgattacacgaaggaaatcaccgga
acgcgcacggagcagcgcgtcaagatgacgcgcatgcggctgaagattgcctcgcgccta
aaggaagcgcaaaacacgaacgcaatgctgacgacgttcaacgaaatcgacatgagcttc
atcatggatttccgtaagcaacatttggaagcgttccaaaagaagtacggcatgaagctg
ggcttcatgtctgccttctgcaaagcagctgcctatgccctgcaggaccaacccgtcgtg
aatgctgtcattgacgaaaacgaaattatctatcgtgattacgtagacatttcggtagcc
gtagcgtcgccgaagggtctggtagtacccgtgctgagaaatgtggaaggtatgaactac
gccgatatcgagctggccatcgctggactggcggataaggcgaaaaaggggacgttggcc
gtagaggacatggatggtggcacctttaccatctcgaacggtggagtgttcggatcgctg
ctcggcacgcccatcatcaatcctccgcagagcgccattcttggcatgcacggcatcttc
gagcgaccgatcgctgtgaagggacaggtggtaatccgacccatgatgtacgtagccctg
acctacgaccatcggttgattgatggccgtgaggctgtcaccttcctgcgcaaggtgaag
gccgctgtcgaggatcctcgcatcgtgctggccggtctgtaa

DBGET integrated database retrieval system