KEGG   Anopheles gambiae (mosquito): AgaP_AGAP004097Help
Entry
AgaP_AGAP004097   CDS       T01036                                 

Definition
AGAP004097-PA
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Brite
KEGG Orthology (KO) [BR:aga00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AgaP_AGAP004097
  Carbohydrate metabolism
   00640 Propanoate metabolism
    AgaP_AGAP004097
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AgaP_AGAP004097
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AgaP_AGAP004097
Enzymes [BR:aga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     AgaP_AGAP004097
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2R
AA seq 387 aa AA seqDB search
MLRAIAVRAGLSRSGQLVAPSVCRAMSSTAGDSNSLVLTEEVGSKGVITLNRPKALNAIN
LEMVRLIYDAMKQWESTKSVVIVKSVGDKAFCAGGDVRAITETSNVELARKFFSTEYRLN
ALIGSYRPTYIAFIDGITMGGGVGLSVHGKYRIATERTMFAMPETAIGLFPDVGGGYFLP
RLEGKLGLYLGLTGFRLKGRDVHKAGVATHYVESKNLAALEQQLLATTSGAEVESVLDRF
SEKRDAGAEFVLAKQLQQINQCFSAPTVEAIFQQLERDGSEWAQNTLKLLHKMSPTSMVV
TQKQLELGGKMDLKTCLKMEYRLAVHHAIDSDFKEGVRALLIDRDQKPRWNPATLAEVDP
ARIEQFFGPLPDGDELQFEEEGPKASL
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgctacgagcgattgcggtgcgcgccggactaagccgatcgggccaactggtcgccccg
agcgtttgccgcgcgatgtcctcgacggccggtgatagcaacagcctggtactgacggag
gaggtcggcagcaagggcgtgatcacactgaatcgcccgaaagcgctgaacgccatcaat
ctggaaatggtccggctcatctacgacgccatgaagcagtgggaaagcaccaagagcgtg
gtcatcgtgaaatccgtcggcgataaggcgttctgtgccggcggggacgtgcgcgccatc
accgagacgagcaatgtggagctggcgcgaaagtttttcagcaccgaataccggctgaac
gccctcatcggcagctatcggcccacgtacattgcgttcatcgacggtatcacgatgggc
ggcggcgtcgggctgtccgtgcacggcaagtaccgcatcgcgacggagcgcaccatgttc
gcgatgcccgagacggccatcgggctgttcccggacgttggcggcggctatttcctgccc
cggctcgagggcaagctcggcctctatctcggcctgaccgggttccggctgaaggggcgc
gacgtgcacaaggccggcgtggcgacgcactacgtggagagcaaaaatctggccgcgctg
gagcagcagctgctggccacgacgagcggtgccgaggtggaaagcgtgctggaccggttc
tcggagaagcgggacgcgggcgccgagtttgtgctggccaagcagctgcagcaaatcaac
cagtgcttcagtgcgccgacggtggaggccattttccagcagctggagcgggacggtagc
gagtgggcacagaacacgctgaagctgctccacaagatgtcccccacctcgatggtggtg
acgcagaagcagctcgagctgggcggcaagatggatttgaagacgtgtctcaagatggag
taccggcttgccgtgcaccatgctatcgacagcgacttcaaggaaggtgtgcgcgccctg
ctgatcgatcgcgatcagaaaccgcgctggaatccggccacactggcagaggtggatccg
gcgcgcatcgagcagttcttcggcccgctgccggacggcgatgagctccagttcgaggag
gaggggcccaaggcatccctgtaa

DBGET integrated database retrieval system