KEGG   Anopheles gambiae (mosquito): AgaP_AGAP004247Help
Entry
AgaP_AGAP004247   CDS       T01036                                 

Gene name
GPXH1
Definition
AGAP004247-PB
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:aga00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:aga00480]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
Position
2R
AA seq 202 aa AA seqDB search
MFSTKSVLLFVVGVLIAYGVNRFYSQSTTTQTDGTMEDYKNAKSVYDFTVKDSQGADVSL
EKYRGKVLLIVNIASQCGLTKGNYAELTELSQKYADKDFKILSFPCNQFGGQMPEGDGEE
MVCHLRSAKAEVGDVFAKIDVNGDGAHPLYKYLKHKQGGTLGDSIKWNFAKFLVNKDGQP
VDRYAPTTSPSSIVKDIDKLLG
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgttttcgacgaaaagtgtccttctgttcgtagtgggtgtattaatagcatacggagta
aatcggttctacagtcagtctacgacaacgcaaaccgacggcacgatggaagactacaag
aatgctaaatcggtgtacgacttcacggtgaaggattcgcaaggggccgacgtcagcctg
gagaagtaccgtggcaaggtgctgctaatcgtcaacattgcctcccagtgcgggctaacc
aagggcaattatgccgagctgaccgagctatcgcagaagtacgcggataaggatttcaaa
attttgtccttcccctgcaatcagttcggtggccaaatgccggaaggcgacggagaggaa
atggtgtgtcatcttcgctcggccaaagcggaagtaggagacgttttcgctaagatcgat
gtaaacggtgacggcgcacatccgctctacaaatatctcaagcacaagcagggtggcact
ttgggtgattcgatcaagtggaactttgccaagtttttggtaaacaaggacggtcagccg
gtggatcgctatgcgcctacaacgtcgcccagcagcattgtgaaggacattgataagctg
ctgggctag

DBGET integrated database retrieval system