KEGG   Anopheles gambiae (mosquito): AgaP_AGAP004270Help
Entry
AgaP_AGAP004270   CDS       T01036                                 

Definition
AGAP004270-PA
Orthology
K14459  
hexosaminidase [EC:3.2.1.52]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Other glycan degradation
Brite
KEGG Orthology (KO) [BR:aga00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    AgaP_AGAP004270
Enzymes [BR:aga01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     AgaP_AGAP004270
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2R
AA seq 705 aa AA seqDB search
MHSRLLIVCWRRKLFFLGASLLFLLALWFWGFLYTTHITEDGGKIVSVRELMLGSAHDGR
HESLLQRLGFHERHDPALDGGSNGVEPHGAAHGEQGSVQLEGDEGGVKFVKPTPGGLRSA
KVRHTNDWDAIMQDRTDEGKQINQQPGGKGQPSRHISDEMRMAAERQSHYEHELKRMGVP
VIAGLGPGGRPPPAQRLVHFDLKGAPPKVSYLRRLMPILKTLGATGILLEYEDMFPYGGS
LLPLAARNAYNRDEILELLKSAFALGLTVIPLVQTFGHLEYALKLKEFAHLRETEDSPQA
LCPSYNASMAFVEELLTQVIEYHMPAENGNLLHKEDIERSTPKLTHIHIGCDEVYRLAEC
PRCRHRLKDQLFLDHVYNVATIVRRRWPHLRVIVWDDMLRHMALDALQASGIGKLVEPMI
WVYAEDIYKFVQSATWEKYAAVFRTAWAASAFKGAHGEGLLMPPIRRHLENTLRWLAVMQ
GEGNRFSHGLQGLALTGWQRYDHFAVLCELLPAALPSLAICLSTAAKGYFDVSARTNPIL
SSLTCPEPTGEHHAWLELHRDSMMVMFSRCMFPGSMIYRFILRLATLTTETEEYTDAIRQ
RRGWLTDYNIRHNFSSAARVDDLLGENYRLLNAVSNLARTAASTLTEVYDHWTYGEFIEQ
RIFPMLEELKRLERAGEGLKKRRVWPQRPLPYLKPFEVLGIDEKT
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atgcattcccgcctgctgatagtttgctggcggcgcaaacttttctttctcggcgcttcg
ctgcttttcctgctggcactgtggttttggggcttcctgtacactacacacattaccgag
gacggtggtaagatcgtgtcggtaagagagctgatgctcggcagcgcacacgacggtcgg
cacgagagtttgctgcagcgattgggtttccacgagcgacacgaccctgccctggacggt
ggcagcaatggagtggagccgcatggtgcagcacacggtgagcaaggatcggttcagctt
gagggcgatgagggaggcgttaagtttgttaaaccgacaccgggtggattgcgatccgca
aaggttcgccacaccaacgattgggatgcaattatgcaggatcgaacggatgaagggaaa
cagatcaatcaacaaccaggtggcaaagggcaaccatcacgtcacatctcggacgaaatg
cgcatggccgccgagcgacagagccattacgagcacgagctgaaacggatgggcgtcccg
gtgattgccggcctaggcccaggcggaagacctccaccggcccaacggttggtgcatttc
gatctgaagggagcgccaccgaaagtgtcctacctgcgacgactgatgccgatcctgaaa
acgctcggtgcgacgggcattctgctagagtacgaagacatgtttccttacggtggctcg
ttgctaccgctggcagcacggaacgcgtacaacagggacgagatattggagctgctcaaa
agcgcgttcgcactgggtctaaccgtcatcccgctggtgcaaacctttggccatctcgaa
tacgcgctgaagctaaaagaatttgcccacctgcgtgagacggaggattcgccgcaagcc
ctttgcccgagctacaacgcttcgatggcattcgtggaggaactgttgacgcaagtcatc
gagtaccatatgccggccgagaatgggaatctactgcacaaggaagatattgaacgatcg
accccgaagctaacccacattcacatcggctgcgacgaggtttaccgcctggctgagtgt
ccacgctgccgccaccggctgaaggatcaactgtttctcgatcacgtgtacaacgtggcc
acgatcgtgcgccgtcgatggccccatctgcgcgtcatcgtctgggacgatatgctgcga
catatggcgcttgatgcactgcaagcctccggcattggaaaactggtcgagccgatgatc
tgggtgtatgcggaagacatctacaagtttgtacagtcggccacgtgggagaagtacgca
gcggtattccgtacggcctgggctgcgtccgccttcaaaggagcccatggcgagggattg
ctgatgccaccgatcaggcgccatctggaaaacacactccgatggctggcagtgatgcag
ggcgagggcaatcggttcagtcacggactgcagggactagccttgaccggctggcagcgg
tacgatcactttgccgttctttgcgagctgcttccggcggccctgcccagcctagcgatc
tgcctttcaacagcggcgaaaggatactttgacgtgagcgcacgcaccaaccctatactc
agcagcctaacgtgcccggagccgacgggggagcatcatgcctggttggagctgcacagg
gactcgatgatggtgatgttttcgcgctgcatgttccctggcagcatgatctatcggttc
atactacgcctggcgacactaacgaccgaaaccgaggagtacaccgatgcgatccggcag
aggcgcggatggctgacggactacaatattcggcacaattttagcagcgcagcacgggtc
gacgatttgcttggcgagaactaccgcctgctcaacgccgtctcgaaccttgcacgaacg
gctgcctccacactaacggaggtgtacgatcactggacctatggtgaattcatagagcag
cgaatttttccaatgctagaggagctgaagcggttggaacgtgccggtgaggggctgaag
aaacgacgtgtctggccacagcgtccgctgccctatctaaagccgtttgaagtgcttgga
atcgacgagaaaacctag

DBGET integrated database retrieval system