KEGG   Anopheles gambiae (mosquito): AgaP_AGAP004298Help
Entry
AgaP_AGAP004298   CDS       T01036                                 

Definition
AGAP004298-PB
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:aga00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    AgaP_AGAP004298
Protein phosphatases and associated proteins [BR:aga01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     AgaP_AGAP004298
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2R
AA seq 170 aa AA seqDB search
MGNETSLPMELCSNFDADEIRRLGKRFKKLDLDNSGALSIDEFMSLPELQQNPLVQRVID
IFDADGNGEVDFKEFIQGVSQFSVKGDKLSKLKFAFRIYDMDNDGYISNGELFQVLKMMV
GNNLKDTQLQQIVDKTIVFADKDEDGKISFDEFCSVVGNTDIHKKMVVDV
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatgaaacctcgctaccgatggagctctgctcaaactttgacgcggacgaaatc
cgtcgattgggcaaacgcttcaaaaaactggatctcgacaattcgggcgccctcagcatc
gatgagtttatgtccctgccagagctgcagcaaaacccgctggtgcagcgtgtgatcgat
attttcgacgcggacggcaatggggaggtcgatttcaaggagtttatccagggcgtgtcg
cagtttagcgtaaagggcgacaaactgtccaagctgaaatttgccttccgaatatatgac
atggataacgatggatacatctcgaatggggaactatttcaggtgttaaaaatgatggtc
ggtaacaatctgaaggatacgcaactgcagcagatcgtagacaagacgatcgtgttcgcc
gacaaggacgaggatggcaagatatcgttcgacgagttctgttcggtggtgggcaacacc
gatattcataaaaagatggtcgtggatgtctaa

DBGET integrated database retrieval system