KEGG   Anopheles gambiae (mosquito): AgaP_AGAP004376Help
Entry
AgaP_AGAP004376   CDS       T01036                                 

Definition
(RefSeq) AGAP004376-PA
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
aga00010  Glycolysis / Gluconeogenesis
aga00052  Galactose metabolism
aga01100  Metabolic pathways
Module
aga_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:aga00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AgaP_AGAP004376
   00052 Galactose metabolism
    AgaP_AGAP004376
Enzymes [BR:aga01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     AgaP_AGAP004376
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-GeneID: 1274524
NCBI-ProteinID: XP_562126
VectorBase: AGAP004376
UniProt: Q5TT05
Position
2R
AA seq 441 aa AA seqDB search
MSSSSAEGNGSPDNNNSRPSGASVTIKSIDSKVEQRGSVTESYEMVDTGKSAPPVTLTVD
GFGTVKHPKTGATETVKRFTWQNTDGMSVQVISYGAIITVMKVPDRNGRVDDVVLGFDDI
PGYQTPNNPYFGATIGRIANRVGGGRFTLNGQEFQVTKNFDKRHQLHGGKIGFDKYNWEA
FVDGTAVTLTHTSPDGDEGYPGAVMVSVRYELKADNRFEALFKAASTKPTPINLTNHSYF
NLAGHATGHEEIYRHVVSINADKITDTDADSIPSGKFICVGGTPYDLRIPRELGPAMAKT
VGKGFDDNFCLTKGTEQGRTFTARVIHPHSGRVLEVYTDQPGVQFYTSNFMPDPIKNINP
KPVNAPEYYEVTRLEPLIPEGAADPPIRGKGRANYCKHGAFCLETQNFPDAINQPNFPSA
VLNPGAQYVHEVVYKFDVLRD
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgagttccagcagtgccgagggaaacggttcccccgataataacaatagccgaccgtcg
ggggcttcagttacaatcaagtcaatagacagcaaagtcgaacagcgtggttcagtgacg
gaaagctacgaaatggtcgataccggcaagagcgccccgccagtcaccctaaccgtggac
ggtttcggcacggtgaagcatcccaagaccggtgccactgaaacggtgaaacgtttcacc
tggcagaacaccgatggcatgtcggtgcaggtcatttcgtacggggccatcatcaccgtg
atgaaggtgcccgatcgcaacggtcgggttgatgatgtggtgctgggtttcgacgacatt
cccggctatcagacaccgaacaatccgtacttcggtgctaccatcgggcgcatcgcgaac
cgagttggtggtggcagattcaccctcaacgggcaggagtttcaggtgacgaagaatttc
gacaagcggcaccagctgcacggcggaaagattgggttcgacaagtacaactgggaggcg
ttcgtggatgggacggcagtaacgcttacccacacatcccccgacggtgacgagggatat
cccggtgcggtgatggtcagcgttcggtacgagctgaaggcggacaatcgattcgaggcg
ctcttcaaggctgcttcgacaaagccaacgcccatcaatctcacgaaccattcctacttt
aacctggccggtcatgcaaccgggcacgaggaaatctatcgccacgtagtgagcatcaat
gcagataagattaccgacaccgatgccgattcgattccgagtggcaaattcatctgcgtc
ggcggcacaccatacgatctgcgcataccgcgtgaactcggccctgcaatggccaaaacc
gtgggcaagggcttcgacgataacttctgccttacgaagggcaccgaacagggccgcacg
tttaccgcacgcgtgatccatccgcacagtgggcgcgtgctggaggtgtacaccgaccag
ccaggcgtgcaattttacaccagcaactttatgccggaccccatcaagaatataaatccg
aaaccggtcaacgctccggaatactacgaagtgactcgcctcgaaccgctcatccccgaa
ggagcggctgatcctccaattcgcggtaaaggtcgcgcaaactactgcaagcatggtgcc
ttctgtttggaaacgcaaaatttccctgacgcaatcaaccagcccaacttcccgtcggcc
gtactaaacccgggcgcacagtacgtgcatgaggtagtgtataaatttgacgtacttcgt
gactaa

DBGET integrated database retrieval system