KEGG   Anopheles gambiae (mosquito): AgaP_AGAP004434Help
Entry
AgaP_AGAP004434   CDS       T01036                                 

Definition
AGAP004434-PA
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:aga00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    AgaP_AGAP004434
Enzymes [BR:aga01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     AgaP_AGAP004434
Transcription machinery [BR:aga03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     AgaP_AGAP004434
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2R
AA seq 760 aa AA seqDB search
MSENPKNQNGEVKHEKSDSNHGGNSSGAQETTRQDSIERIMMRKQKVYQLPRNQKLTKLS
MYSSCQANECRCSGWKTPEENRHKDVEVDYCPDFAEECRNPNCKHSLETHIQHLGDITEE
QMNELLGAIVDVENLYMSMLRETDTDTKKVYAYLFRLLRQCILTRTQAVIRGPLGDPPFE
QPSISKAVTNFVMHKYGHLHQAELDSMTDVAKTFLHCLNHWNFEAPSARQDLVSQEDVSN
YKINYTRWLVFCHVPAFCSSLRHFETSVVFGRTLLKAVYQYVYQQLLMRCKIERDRMPPE
KRIMLTQLPKFLEALKQEVVNEDSPIWSPNFKPTSSLLLHKTKRQHEGSSLSGTGKKMGD
AKRYKKESDCEDLSDDVVARALKRINDSNYSSRAEVVFPPNAPRDEAAKAEENRREIEFH
VVGNSLTKPVTKQSMLWLLGLHSVFAHQLPGMPREYISQLVFDPKHKTLALIKEGRPIGG
ICFRTFVSQGFTEIVFCAVTSSEQVKGYGTHLMNHLKDYSTQRGIKHFLTYADEFAIGYF
KKQGFSKDIKVARHVYAGFIKEYEGATLMHCELHPSLIYTQFSSVIRKQKEIVKELITQR
QQEVQKVHPGLTCFKEGVRSIPIESIPGLREVGWRPTFRAQRTARPLEESADPDKLANSL
SGVLLAVRQHTAAWPFLKPVNQAEVPDYYDHIKYPMDLKTMNERLKNKYYVTRRLFMADM
ARIFTNCRLYNSPETEYYRCANTLERYFQTKMKEIGLWDK
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagaatccaaaaaatcagaacggcgaagtgaagcatgaaaagtccgactcgaat
catggcggcaacagcagcggagcgcaagaaaccacacgccaggatagcatcgagcggatc
atgatgcgcaaacaaaaggtttatcagttaccgagaaatcaaaagctgaccaagctttcc
atgtactcgtcctgtcaagcaaacgaatgccgctgcagtggctggaaaacgcctgaggag
aatcgccataaagatgtggaggtcgattattgccccgatttcgctgaagagtgccgaaat
ccaaactgtaagcacagtcttgagacgcacattcagcatctaggtgatattaccgaggaa
cagatgaacgagctgctgggggccattgtggatgtggaaaatttgtacatgagcatgctc
cgggaaacggataccgatacgaagaaggtatatgcttatctgttccgtttgttgcggcag
tgcattctaacacgtacgcaggccgttatacgaggaccgctaggagatcctccgtttgaa
cagccctcgatttccaaagcagtcaccaacttcgttatgcacaagtatggtcatctccat
caggcagaactggactctatgaccgatgttgcgaagacgtttctgcactgtctaaatcat
tggaattttgaagcaccgagtgcgcggcaggatctagttagccaggaggatgtttcgaac
tacaaaattaactacacgcggtggctggtgttctgtcacgtgccggctttctgcagttca
ctgcggcactttgaaacgtctgtcgttttcggccgcacactgctaaaggccgtctaccag
tacgtataccagcagttgctgatgcgttgtaagattgagcgcgatcgaatgccgccggaa
aaacgtatcatgcttacgcagctgcccaaattcctcgaagcacttaagcaggaggtagtg
aacgaagattcgccaatctggtcgccaaactttaagccaacgtcgtcgcttctgctgcac
aaaaccaagcgccagcacgaaggatcgtcattgtcggggacaggcaagaagatgggagat
gcaaagcgctacaaaaaggaatcagactgcgaggatctgtccgatgatgtggtagcgcgt
gcactgaagcgcataaacgacagcaactactccagccgggcggaggtcgtctttccaccg
aacgcacctcgtgatgaagcggctaaggcagaagaaaatcggcgagaaatcgaattccat
gtcgttggcaactcgctcaccaaaccggtaacgaaacaatcaatgctgtggttacttgga
ctacacagcgtctttgcccatcagctgccaggaatgcccagggagtacatcagccagcta
gtgtttgacccgaaacacaaaacgctagccttaattaaagaaggtcgtccgattggtgga
atatgtttcagaacattcgtttcgcaaggcttcacagaaattgtgttctgtgcagttaca
agcagcgaacaggtgaaggggtatggtacgcatctcatgaatcatttgaaagactacagt
acccagcgtggcattaaacatttcctcacgtacgctgatgagtttgcaatcggttacttc
aagaagcaaggattttccaaagacatcaaggtagcgcgccacgtgtacgctggattcata
aaagaatatgaaggtgcaacgctcatgcactgtgaactccatcccagcttaatttacacg
caatttagctcagtcattcgaaagcaaaaggagatcgtaaaagaattgatcactcagcgg
cagcaggaagtgcaaaaggttcaccctgggctgacctgctttaaggaaggtgttcgtagt
atacctatcgaatcgataccgggtttgcgagaagtaggatggagaccgacattccgagca
cagcgaacagctcgaccgctagaagaatcggcagacccggataagctggccaattcgctg
agcggagttttgcttgctgttcggcagcatacagctgcatggccgttcctgaagccggtc
aatcaggcggaggtgccagactattacgatcatattaaatacccgatggatctcaaaacg
atgaatgaacgactcaagaataaatattacgttaccagacggttgttcatggctgatatg
gcccgtatttttaccaattgtcgtctttacaattcaccggagacagaatactatcgctgc
gccaacactctggaacggtattttcaaaccaaaatgaaggaaatcggtctgtgggataaa
tga

DBGET integrated database retrieval system