KEGG   Anopheles gambiae (mosquito): AgaP_AGAP004654Help
Entry
AgaP_AGAP004654   CDS       T01036                                 

Definition
AGAP004654-PA
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aga00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    AgaP_AGAP004654
Enzymes [BR:aga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     AgaP_AGAP004654
Transfer RNA biogenesis [BR:aga03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    AgaP_AGAP004654
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2R
AA seq 308 aa AA seqDB search
MASSAPLVMRLVGSSIKIAHRAGNIIRDVMRRGDLGIVEKGKDDLQTEADRSAQRCIVAS
LSKLFPNATIIGEEGPSDLNVPEDWLITESNIDFLEKHKCPDAFVNLKESDVVIWVDPLD
GTSEYTQGFLERVTVLIGIAVNERAVGGIIHQPYYEHDTGDIGRTIWGLHGCGTGGILPV
EPPSDRFLVTTTRSHSNSIVQSALDAIAPDEVLRVGGAGYKVLQLLEGKAHAYVFASAGC
KKWDTCAPEAVLEANGGTLTDMLGRHYQYGKDVSFPNSSGVLGTVAGVSHDDILAKIPDN
VKQAMSMY
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggcgagttctgccccgttggtaatgcgcttggtcggaagttcgatcaagattgcacat
cgagctggtaatattattcgtgatgtgatgcgtcgcggtgatttgggaatcgtcgaaaaa
ggaaaagatgatcttcaaaccgaagcggaccgttcagcgcaacgctgtatcgtagcatcg
ctgtccaagctcttccctaatgctaccattattggcgaagaaggcccaagtgatctgaat
gtaccggaagattggctgataacagaaagcaatatcgattttttggaaaagcataaatgt
cctgatgcgttcgtcaacttaaaggagtcggatgtggtgatttgggtggatccactggac
ggaacaagcgaatatacgcaaggatttcttgaacgcgttactgtgctgatcggtatcgca
gtcaacgaacgagctgttggcggcatcatacatcaaccttactatgaacacgatactgga
gatatcggacgtactatctgggggttgcatggatgcggtacgggtgggattctgcccgtg
gaacctccttcggatcgatttttagtcaccactacgcgttcccattccaacagcattgtg
cagtccgctttggatgccatagcaccagatgaagtattacgcgtgggtggtgcaggttac
aaggtgctacagctgcttgaaggtaaagcacatgcatacgtttttgcgagtgcagggtgt
aaaaagtgggacacctgcgccccggaagccgttctagaggccaacggtgggacacttaca
gatatgctgggacgtcactaccaatatggaaaggatgtaagcttcccaaacagcagtgga
gttttgggtaccgttgctggtgtgtcacatgatgatattctcgccaaaatacccgataac
gtaaaacaggctatgagtatgtactag

DBGET integrated database retrieval system