KEGG   Anopheles gambiae (mosquito): AgaP_AGAP005226Help
Entry
AgaP_AGAP005226   CDS       T01036                                 

Definition
AGAP005226-PA
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
aga  Anopheles gambiae (mosquito)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2L
AA seq 180 aa AA seqDB search
MYHEKQQRELCALHALNNLFQDKSSFTKTQLDQICQNLSPNEYINPHRSILGLGNYDVNV
IIAALHMKDCEAIWFDKRKDPSRIDTSKIIGFILNVPSNYKVGFVRLPIQRRHWIAIRQI
NKEYWNLDSKLDAPQCLGDESNMLQYLREQLQSNDKELFVVCTCEVDKTQQWLLPDNEQR
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgtaccacgagaagcaacaacgagagttgtgcgcgttgcatgcgctgaacaacctgttt
caagacaaatcgtccttcaccaaaacacagctcgatcaaatctgccaaaatctctctcca
aatgagtacatcaatccgcacagatccatcctgggactcggaaactatgatgtgaatgtt
atcattgctgcattacacatgaaagattgtgaagcgatttggttcgacaagcgaaaggat
ccatcgcgaatcgatacatcgaaaataatcgggttcatactgaacgttccaagcaactac
aaggtggggtttgtgcgtctgcccattcaacgccgacactggatagccattcgacaaatt
aacaaagagtactggaacctagactccaagctggatgctccccaatgcctaggagatgag
tcgaacatgctacagtacctacgagagcaactgcaaagcaatgacaaagagcttttcgtc
gtgtgcacatgcgaggtggacaaaacgcaacaatggttactaccggacaacgaacagcgg
tga

DBGET integrated database retrieval system