KEGG   Anopheles gambiae (mosquito): AgaP_AGAP005381Help
Entry
AgaP_AGAP005381   CDS       T01036                                 

Definition
AGAP005381-PC
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:aga00520]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:aga00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:aga00603]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series [PATH:aga00604]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:aga00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:aga04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2L
AA seq 612 aa AA seqDB search
MAEVQYLVTALFALFVCTGIGVHSEGEAVWGYQCKNDRCVKTAISEESYPAANAISLPAC
RLFCGEGAGLLWPQPTGQLAVENELAHIDPDQVWFQWDEKLTQLVGLWEANRDRFRSQLK
KRAQGAALKPGGKAVRIKLNVTDDSLALNYETDESYSLTVVAGSSKDELQATIEAKTFFG
ARHGLETLSQLVLYDDIRNELQMVARARVSDAPAFPHRGLALDTSRNFIDLESLRRTLDG
MAMVKLNVFHWHITDSQSFPLVVKSRPTLHTYGAYSRRDVYTADDVQRLVQYALERGIRI
VPELDAPAHVGEGWEKLGVTACFNYQPWENYCVEPPCGQLDPTKDAVYDILEDVYREMNA
MFNRSDLFHMGGDEVSVRCWNATGSIQRWMGEQEWGLQEGDFMKLWNYFQTEALRRLDKT
LPVAEGGKPRPIVMWTSKLTESPYLEQYLDKDRYIVQVWTTGNDSKVANLLQKGYRLIMS
NYDALYLDCGFAGWVTDGSNWCAPYIGWQKVYNNDLMAIGGPYAQQILGGEAALWTEQSD
THTLDNRLWPRLSAHAERLWSNPRAGWQMAEARMLLHRERLIEEGIAANSIQPKWCLQNE
ANCPIGGDGGRS
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagtacaatatcttgtgacggcattatttgctctatttgtttgcactggaatc
ggagtccactcggagggcgaagccgtatggggctaccagtgcaagaacgatcgctgcgtc
aaaacggccatctcggaggaatcatacccagcggcgaacgccatcagcctgccggcatgt
cggctgttctgcggcgaaggagctgggctcctctggccacagccaaccgggcagctggcg
gtggagaacgagctcgcccacatcgaccccgaccaggtgtggttccagtgggacgaaaag
ctgacccagctcgtcggtctgtgggaagcgaacagggaccgtttccgcagccagttgaaa
aagcgtgcccagggcgcggcgctcaaacccggcggcaaggcggtgcgaatcaagctgaac
gttacggatgactctctcgcgctaaactacgaaaccgacgaaagttactccctaaccgtc
gtggccggctctagcaaggacgagctgcaggcaacgatcgaggcgaaaacgttcttcggt
gcccggcacgggctggaaacgctgtcccagctggtactgtacgacgacatccggaacgag
ctgcagatggtagcccgggcccgggtgtccgatgcaccggccttcccgcaccgtggcctc
gccctggacacgtcgcgcaatttcatcgatctcgagtcgctgcgccgcacgctcgacggc
atggcgatggtgaagctgaacgtgttccactggcacatcacggactcgcagagcttcccg
ctggtggtgaaatcgcgccccaccctgcacacctacggggcgtacagccggcgggacgtg
tacacggcggacgacgtccagcggctggtgcagtacgcgctcgagcgcggcatccgcatc
gtgcccgagctggatgcaccggcccacgtcggcgagggctgggagaagctgggcgtgacg
gcctgctttaactaccagccgtgggagaactactgcgtggagccaccgtgcggccagctc
gatccgaccaaggacgcggtatacgacatcctggaggacgtgtaccgggagatgaacgcc
atgtttaaccggtcggacctgttccacatgggcggggacgaggtgtcggtgcggtgctgg
aacgcaaccggcagcatccagcgctggatgggcgagcaggagtggggcctgcaggagggc
gacttcatgaagctgtggaactacttccaaaccgaggcactacgccggctggacaaaacg
ctcccggtggcggagggtggtaagccgcgcccgatcgtgatgtggacgagcaagctgacc
gagtcgccgtacctcgagcagtacctggacaaggaccggtacatcgtgcaggtgtggacg
acgggcaacgacagcaaggtggccaatctgctgcagaagggctaccgcttgatcatgtcc
aactacgacgcgctctacctggactgtggctttgccggctgggtgacggacggtagcaac
tggtgcgcaccgtacatcggctggcagaaggtgtacaacaacgatctgatggcgatcggt
ggcccgtacgcgcagcagatactgggcggcgaggccgccctctggacggagcagtccgac
acgcacacgctggacaaccgtctgtggccccggctgagcgcgcacgccgagcggctgtgg
agcaatccgcgggccggctggcagatggccgaggcgcgcatgctccttcaccgcgagcgg
ctaatcgaggagggcattgcggccaacagcattcaaccgaaatggtgcctgcagaacgaa
gccaactgtccgatcgggggcgatggtgggcgttcgtaa

DBGET integrated database retrieval system