KEGG   Anopheles gambiae (mosquito): AgaP_AGAP005431Help
Entry
AgaP_AGAP005431   CDS       T01036                                 

Definition
AGAP005431-PA
Orthology
K09585  
thioredoxin domain-containing protein 10 [EC:5.3.4.1]
Organism
aga  Anopheles gambiae (mosquito)
Brite
Enzymes [BR:aga01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     AgaP_AGAP005431
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2L
AA seq 428 aa AA seqDB search
MYTLCKLLIALCCFTTLAHSSRVLELSDRFLDVRNEGQWFVMFYAPWCAHCKKLEPVWAL
VAQALYNTNIRVGRVDCTRFTAVAQHFKVNAYPTIIFVKGPYDYVYNGERSKEELIHFVN
RMSGPPVQLVTRADSIDILKSNNPIFFTYVGKQSGLLWDVFYSAAESYQAHGYFYATSVE
IAKRHFDVDTVPAALVYKERSHYYFPYSDNFERIEPAHLNDTLFRWVNEERFATFPKVTR
SNIHHLVQTQKYLVLAVVEENKLSEIAAHEQEFRDMVEIFVHKNKHKYHGRFQFGWVGTP
ELARSIAMDSLPTPHLLVLNASTNEHHIPEDDPLQLTPEAIEIFLDSIHNQTAPTFGGNS
LPVRIYRAWFEAKTSLYEMWIGNPVLTTVLFGLPLGFLSLIMYSICCADILDAEEEDDGA
DQRHEKNE
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgtacacgctgtgcaagctactgattgcgctgtgctgtttcacaacgttagcccacagt
tcccgggtgctagagctaagcgatcggtttctggacgtgcggaacgagggccaatggttc
gtgatgttctatgcgccctggtgcgctcactgcaaaaagctcgagccggtgtgggcgctc
gtcgcccaggcgctgtacaacacgaacatccgggtcggccgggtcgactgcacacgcttc
accgcggtggcgcagcactttaaggtcaacgcttatccgacgattattttcgttaaagga
ccgtacgattatgtgtacaacggggagcgttcgaaggaggagctgatccatttcgtgaac
cgcatgtccggcccaccggtgcagctggtaacgcgtgcggacagtatcgacatcctcaag
tcgaacaacccgatctttttcacgtacgtcggcaagcagtcgggattgctgtgggacgtg
ttttacagtgcggccgagtcgtaccaggcgcacggttacttctacgccacctcggtcgaa
atagcgaagcggcactttgacgtggacacggtcccggcggcgctggtgtacaaggagcgc
agccactactacttcccctactcggacaacttcgagcggatcgagccggcgcatctgaac
gacacgctgttccgctgggtgaacgaggagcggttcgccaccttcccgaaggtgacgcgc
agcaacattcaccatctggtgcagacgcaaaagtatctcgtgctggcggtggtggaggag
aacaagctcagcgagatagcggcccacgagcaggagttccgcgacatggtggagatcttc
gtgcacaagaacaagcacaagtaccacgggcggttccagttcggctgggtcggtacgccc
gagctggcccgctcgatcgcgatggacagcctgccgacgccccatctgctggtgctgaac
gcgtccaccaacgagcaccacatccccgaggacgatccgctccagctgacgccggaagcg
atcgagatcttcctcgacagcatccacaaccagacggcgcccacgttcggtggcaactcg
ctgccggtgcgcatctaccgtgcctggttcgaggccaaaacgtccctgtacgaaatgtgg
atcggcaatccggtgctcacgaccgtgctgttcgggctgccgctcggcttcctgtcgctc
atcatgtactcgatctgctgtgcggacattctcgacgccgaggaggaggacgacggggcc
gaccagcggcacgagaagaatgagtaa

DBGET integrated database retrieval system