KEGG   Anopheles gambiae (mosquito): AgaP_AGAP005540Help
Entry
AgaP_AGAP005540   CDS       T01036                                 

Definition
AGAP005540-PA
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
aga  Anopheles gambiae (mosquito)
Brite
Enzymes [BR:aga01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     AgaP_AGAP005540
Peptidases [BR:aga01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   AgaP_AGAP005540
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2L
AA seq 322 aa AA seqDB search
MADSAGEWCLIESDPGVFTELIKEFGVDGVQVEELWSLDENSFKDLEPVHGLVFLFKWVK
DDEPAGSIVQDSRLEKIFFAKQVINNACATQAILSILLNATHPDIKLGSTLTDFKEFACT
FDAYNKGLALSNASQIRTVHNSFARQTLFELDNKSSGKEDVFHFVGYVPVDGRLYELDGL
KEGPIDHGAVGPGQDWLQVVRPIIEKRMLKYSKGEIHFNLMAIVSDRQLIYQQQIDQLLQ
GDESEMETDAKQDKINHLRVLIEDEAAKRKQYRTENVRRKHNYLPFIVELLKALAENGQL
MPLYEKAKQRALEREAAKSKQS
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggcggacagtgcgggagaatggtgcctgatcgagagtgatcccggcgtattcacagag
cttatcaaagagttcggcgtggacggcgttcaggtggaagagctgtggagtttggatgag
aacagtttcaaggatctcgaaccagtgcacgggctggtgtttctcttcaagtgggtaaag
gacgacgaaccggccggatcgatcgtgcaggacagccggctggagaagatcttcttcgcg
aagcaggtcatcaacaacgcgtgcgctacacaggccatcctgagcattctgctgaacgca
acccatccggacattaagctcggtagcacgctgacagattttaaggagtttgcctgcacc
ttcgacgcgtacaacaagggcctggcgctgagcaatgccagccagatacgcacggtgcac
aactcgttcgcccggcaaacgctgttcgagctggacaacaagagctcgggcaaggaggac
gtgttccacttcgtcgggtacgtgccggtggacggtcggctgtacgagctggacgggctg
aaggagggtccgatcgaccacggtgcggtcgggccgggacaggattggctgcaggtggtg
cgacccatcatcgagaagcgaatgctgaagtacagcaagggcgagatccatttcaacctg
atggccatcgtgtcggaccggcagctgatctaccagcagcagatcgatcagctgctgcag
ggcgacgagtcggagatggagacggacgcgaagcaggacaagatcaatcatctgcgcgtg
ctgatcgaggacgaggcggcgaaacggaagcaatacaggacggaaaacgttcgccgcaag
cacaactatctgccgttcatcgtggagctgctgaaggcgctggccgagaacgggcagctg
atgccgctgtacgagaaggcgaagcagcgggcactggagcgggaggcggcgaaatcgaag
caatcataa

DBGET integrated database retrieval system