KEGG   Anopheles gambiae (mosquito): AgaP_AGAP005618Help
Entry
AgaP_AGAP005618   CDS       T01036                                 

Definition
AGAP005618-PA
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:aga00270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2L
AA seq 183 aa AA seqDB search
MVRAWFMDNEPTDQRLEHQLDPPKFLTLDELFKSTGVEYFKINIPTYDTDGVLGKIRNDR
GYSYEDEITCSEACLPDYANKLKSFFTEHLHTDEEIRLVLDGSGYFDVRNGPDDAWVRIE
VVAGDLIIIPSGIYHRFTLDMKNYIKAKRYFVGEPVWLPYNRPADEMDCRKDYLKRLEAG
FAA
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atggtgcgtgcctggtttatggacaatgagccgaccgatcagcgtctggagcaccagctc
gatccgcccaagttcctgacgctggacgagctgttcaaaagcaccggggtggaatatttt
aagattaacattccaacgtacgatacggacggggtgctggggaagatccgcaacgatcgg
ggctactcctacgaggacgaaatcacctgctccgaggcgtgcttgcccgattacgccaac
aagctgaagtcgttcttcaccgagcatctgcacacggacgaggagatccggctggtgctg
gacggttccggttactttgacgtgcgcaatggtccggatgatgcatgggtacggatcgag
gtcgttgccggtgatttgatcattattcccagtggaatctatcatcgcttcacgctggac
atgaagaactacatcaaagccaagcgttactttgttggcgaaccggtctggctgccttac
aaccgcccagcagacgagatggactgtcgcaaggactatttgaagcggttggaagctggc
ttcgccgcctaa

DBGET integrated database retrieval system