KEGG   Anopheles gambiae (mosquito): AgaP_AGAP005711Help
Entry
AgaP_AGAP005711   CDS       T01036                                 

Definition
AGAP005711-PA
Orthology
K02223  
circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Circadian rhythm - fly
Class
Organismal Systems; Environmental adaptation; Circadian rhythm - fly [PATH:aga04711]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2L
AA seq 1030 aa AA seqDB search
MDEDPDDKDDTKRKSRNLSEKKRRDQFNLLVNELSSMVSSNSRKMDKSTVLKSTIAFLKS
HNEIAVRSRVHEIQTDWKPSFLSNEEFTHLILEALDGFIIVFSSTGRVFYASESITSLLG
HLPSDLLNMTVYDMVYEDDQNDLYNILLNPTTVVDPLQTGISRENQVTFSCYIKRGTVDY
RADVSYEHVQFTGYFRSDVDTESLMTTSRFSGYTSDADSRLVFVGTGRLQTPQLIREMSI
VDNTKSEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSGYDYYHFDDLEKVVACHEAL
MQKGEGTSCYYRFLTKGQQWIWLQTRFYITYHQWNSKPEFVVCTHRVVSYADVMKQMRNQ
TAGDSKFSEDADSISVHGVERKFQQSSSQSLLATSPWSSKSSRTSRIAPTPGVSPTGLSN
RGRHRYNTYHGPGSDSATSISTESHTSRQSLVTQHSRSRMRTSTFPSKVSSHGSQSDRNS
MSHFLLQQPQQSHGGHQLPSGQLQHQQQHLPQQQQHQQQQQQQPQHPLQHQQPHPLLQPH
QQLQGHQAQQPHQQLPPQQQPHPAMIQNPPDVYPHQLQTQHPLQQQQQQQQQSQQPSQQQ
QSHQQLAGLQQPGTVQQQQSHQQPQHQQPQQQQPPLPQPSTTAALRPPPATIITPPVTQI
LTATGFIEPQQYLTAIPVQSVAGFTETAPGVLSPIQSTSPHGAYAVAHHPAVTGTGGVVL
TPSQNQVQDQLQRKHEELQHLILQQQEELRRVQEQLLMARYGLLPSIVSLPFPPGTGNGP
GPGPSVGPPGERCASGGSFLQAHHQGNSYHHHHYHPSAAQAQQQQQQQQQQHPPSHGGVH
HAQQPQHPLQDQQQLCIGPPDQKPILHPDPEQLNFTDTGQGKLGEPNEMISYMQLTPVPL
HHLQHQSSQSSTSSTPATSMMSQQQKQHQQQQHQQQQQHMQMGAPPDGGTGAGGNSNNNS
NGNTIGLLQYQMAAEQAQILFTSGMEQQQGQQQQQPAVQQQQQQQQQQQHQGAGSSDAGS
RTCPSQTSEM
NT seq 3093 nt NT seq  +upstreamnt  +downstreamnt
atggatgaagatccggatgacaaggatgacacgaaacgcaagtcccgcaatctgagcgag
aagaagcgccgcgatcagtttaacctgctggtgaacgagctcagctcgatggtgtcctcc
aacagccggaagatggacaagtcgaccgtgctcaagtcgacgatcgcgttcctgaagagc
cacaacgagatagcggtgcggtcgcgcgtgcacgagatccagaccgactggaagccctcc
tttctctcgaacgaagagtttacccacctgatactggaagcgctggacgggttcatcatc
gtgttctcctccaccgggagagtattttacgcctctgaaagtattacctcgctgctaggg
catttaccgagtgaccttctgaacatgaccgtgtacgatatggtgtacgaggacgaccag
aacgatctgtacaacatactgctgaacccgacgacggtggtcgatccgctgcagacgggc
atcagccgggagaaccaggtcaccttctcctgctacatcaagcgcggcacggtcgactat
cgggcggacgtgtcgtacgagcatgtccagtttaccggctactttcgcagtgacgtcgac
acggagtcgctcatgacgacgtcccggttcagcgggtacacgagcgatgccgactcgcgg
ctcgtgttcgtcgggacgggccggctccagacgccccagctcatacgcgaaatgtcgatc
gtggacaacaccaagagcgagttcacgtcccgccacagcctcgagtggaagttcctgttt
ctcgaccaccgcgcgccacccatcatcggttacctcccgtttgaagtgctgggaacttcc
gggtatgactattatcattttgacgatctggaaaaggtggtggcttgtcatgaagcattg
atgcagaagggcgaagggacctcgtgctactaccggtttctcaccaagggccagcagtgg
atctggctgcagacgcggttctacatcacctaccaccagtggaactcgaagccggagttt
gtcgtctgcacgcaccgggtcgtgagctacgcggacgtgatgaagcagatgcgcaaccag
acggcgggtgacagcaagttctcggaggacgcggacagcatcagcgtgcacggggtcgag
cgaaagtttcagcaatcgtcgtcccagagcctgctggcgacctcgccctggagctcgaag
agttcgcgcacgtcccggatcgccccgacgccgggcgtctcaccgacggggctgtccaat
cggggccgccatcggtacaacacgtaccatgggcctgggtcggattcggcgacgtccatt
tccacggaatctcacaccagccggcagtcgctcgtgacgcaacattcgcgctcccgcatg
cgtaccagcacgttcccgtcgaaggtttcctcccacggcagccagtcggacagaaactcc
atgtcccactttctgctgcagcagccgcaacaatcgcacggcggtcatcagctaccgtcc
ggccagctgcagcatcagcagcagcatctaccgcaacagcagcagcatcagcagcagcag
caacagcagccccaacatccgcttcaacatcaacagcctcacccgctgctgcagccccat
caacagctgcagggccaccaagcgcagcaaccacatcagcagttgccgccgcaacagcag
ccacacccggcgatgatacaaaacccaccggacgtatacccgcatcagctacagactcaa
catcctctccagcaacaacaacagcagcagcagcagtcacaacaaccctcacagcaacaa
cagtcccaccagcagctagctggactgcagcagcccggaacagtacagcagcaacaatca
caccaacaaccacaacaccaacaaccacaacagcagcagccaccactcccgcaaccatca
accacggccgcgttacgaccgccgcccgccaccatcattaccccgccggtcacgcagatc
ctcacggcgaccgggttcattgagccgcagcagtatttgaccgccatcccggtgcagtcg
gtcgccggctttaccgagacggccccgggcgtactgtcgccgatccagtccacctcaccg
cacggggcgtacgcggtggcgcaccatccggccgttaccgggacgggcggggtcgtccta
acgcccagccagaaccaggtgcaggatcagctgcagcgcaagcacgaggagctgcagcac
ctgatactgcagcagcaggaagagctgcggcgggtgcaggagcagctactaatggcccgg
tacggtctgctgccgtccatcgtttcgctcccctttccaccgggcacgggaaacgggccg
ggaccgggcccgagcgttggaccgcctggggaacggtgcgctagcggtggttcgtttctg
caggcccatcatcagggaaactcgtaccatcatcaccattaccatccttccgcggcacag
gcacagcagcagcaacagcagcagcaacagcaacatcctcctagccatggaggagtgcac
catgcacagcagccacagcatccgctgcaagatcagcaacagctttgcatcggcccgccg
gaccaaaaaccgatcctgcatcccgacccggagcagctcaactttaccgacaccgggcag
gggaagctgggcgaaccgaacgagatgatatcgtacatgcagctgacgccggtcccgctg
caccatctccagcaccaatcgagccaatcgtccacctcgtccacacccgccacgtccatg
atgagccagcagcagaagcagcatcagcagcagcaacaccagcagcagcagcagcacatg
cagatgggtgctccgcccgacggtggcactggagcgggtgggaacagcaacaataacagt
aatggaaacaccataggactgttgcagtaccagatggcggcggaacaggcgcaaatcctg
ttcacgtccggcatggagcaacagcagggccagcagcaacaacaacccgccgttcaacag
caacagcagcagcagcagcagcagcaacatcaaggtgcaggtagttccgatgccggttcc
aggacctgtccctcgcaaactagtgaaatgtag

DBGET integrated database retrieval system