KEGG   Anopheles gambiae (mosquito): AgaP_AGAP005817Help
Entry
AgaP_AGAP005817   CDS       T01036                                 

Definition
AGAP005817-PA
Orthology
K02089  
cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
aga  Anopheles gambiae (mosquito)
Brite
Enzymes [BR:aga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     AgaP_AGAP005817
Protein kinases [BR:aga01001]
 Serine/threonine protein kinases: CMGC group
  CDK family
   AgaP_AGAP005817
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2L
AA seq 302 aa AA seqDB search
MNTSNYEELGVIGTGAYGTVYRARDLKNAGTIVALKKVRVALTEDGVPMSTLREIFMLKQ
LDTFGHPNVVKLLDVCQGQRLEREGQLVLFLVFEHLDHDLDEYIKRLPPKGMPPATIQRL
SREMLTGIDFLHSHRIIHRDLKPQNLLISSDGHLKLADFGLAKTYDFEMKLTTVVVTLWY
RAPEVLLGEAYNSSVDIWSAGCIIAEMFQRQALFPGTAEGNQLERIFELTGRPSEAQWPR
GISIVRENFRSTQRREPREFCPKLCDNANDLLKSMLAFSRHERPSARQCLNHAYFKQEPM
PT
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaataccagcaattacgaggagctgggtgtgattggtacaggagcttacggtaccgtt
tacagggcacgggatctgaagaatgctggtacaatcgtcgcactgaagaaggtgcgcgtc
gcactgaccgaagatggcgtcccgatgtcgacgttgcgggaaattttcatgctcaaacaa
ctcgacacctttgggcatccgaatgtggtgaaactcctagatgtgtgtcaagggcaacgg
ctagagcgcgaagggcagttggtgctgtttctagtgttcgagcatctggatcacgatctg
gatgagtacattaagcgtctaccaccgaaaggaatgcctccggccactatacagcgacta
tcgcgcgaaatgcttaccggcatcgacttcctgcactcgcaccgcatcatccaccgggac
ttgaagccgcagaatctcctcatctcgagcgacggccacctgaagctggccgactttggg
ctcgccaaaacgtacgactttgagatgaagctaacgacggttgtggtgacgctttggtac
cgtgctccggaagtcctgcttggcgaagcgtacaacagctcggtcgacatctggagtgcg
ggctgtatcattgcggaaatgttccagcggcaagcgttgttcccgggcacggccgagggc
aatcagctggaacgaatattcgaattaactggccgcccatcggaagcgcagtggccgagg
ggcatttcgatcgtgcgggaaaacttccgctccacccagcggcgggaaccgcgcgaattc
tgcccgaagctgtgcgacaatgcgaacgatctcctaaagagcatgctcgccttcagccgg
cacgaacgtccgtccgcaaggcagtgccttaaccatgcctacttcaaacaggaaccgatg
ccgacgtaa

DBGET integrated database retrieval system