KEGG   Anopheles gambiae (mosquito): AgaP_AGAP005846Help
Entry
AgaP_AGAP005846   CDS       T01036                                 

Definition
AGAP005846-PA
Orthology
K01189  
alpha-galactosidase [EC:3.2.1.22]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Lysosome
Brite
KEGG Orthology (KO) [BR:aga00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    AgaP_AGAP005846
  Lipid metabolism
   00561 Glycerolipid metabolism
    AgaP_AGAP005846
   00600 Sphingolipid metabolism
    AgaP_AGAP005846
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    AgaP_AGAP005846
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    AgaP_AGAP005846
Enzymes [BR:aga01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     AgaP_AGAP005846
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2L
AA seq 428 aa AA seqDB search
MVNPKVDIVLLGALFVCTALVVHALDNGLAHRPPMGWMSWERYRCITDCSKYPDECISEA
LFKRMADLMVSEGYRDAGYEYVNIDDCWMADERDEDGVLQPNKERFPNGIKHLADYIHER
GLKFGIYQDIGTKTCAGYPGMVGYFKLDAETFADWGVDFIKIDGCYADVELMVNDYIKFG
EYMNRTGRPILYSCSWPAYQEYDGIIPDYDQLKETCNMWRNWGDIEDSHQSVVEITKYFS
DHQNRIVPHHGPGHWNDPDTLILGNYGLSYDQSKSQLAVWTVMGAPLLISNDLAKVRPEI
KELLLNKAIIRVNQDPLGIQGRLVKTVNKIEIWKRPIMPRVGHELTQAIAFVSRRADGAP
YPLRVKLQEDVGLSNSTNIKGYKVYDLFDAKAVPLLVRAGSTFETRINPTGANLYRFVPQ
FGTNFISF
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggtgaacccgaaagtcgatatcgttctactaggagcgctgttcgtctgtaccgcgctg
gtagtacacgctctcgacaatggtcttgcgcaccggccaccgatgggttggatgagctgg
gagcgataccggtgcataacggactgcagcaagtatccggatgagtgcatcagcgaggca
ctgttcaagcgcatggccgacttgatggtttccgagggctaccgggacgctggctacgag
tacgtgaacatcgacgactgctggatggcggacgagcgcgatgaggatggggtgctgcaa
ccgaacaaggaacggtttcccaacggaatcaaacatttggctgactatatccacgagcgt
ggccttaagtttggtatctatcaagacattggcacgaaaacgtgcgccggctaccctggg
atggtgggctactttaagctggatgctgagacgttcgccgattggggtgtggactttatc
aaaatcgatggatgctacgcggacgtcgagctgatggtgaatgattacatcaagtttgga
gagtatatgaaccggacgggtcgcccgatactgtactcctgctcgtggcccgcctaccag
gagtatgatggaatcattcccgattacgatcagctgaaggaaacctgtaacatgtggcgt
aactggggtgacatcgaggattcgcaccagtcggtggtggagattacgaaatacttttcc
gaccatcaaaacagaatcgtcccacaccacggaccgggccactggaatgatcccgatacg
cttatcctgggcaattatgggctgagctacgatcagagcaaatcgcagctggccgtttgg
accgtcatgggcgcaccgctgctcatatcgaacgatctggcgaaggtacggccggagata
aaggagctgctgctgaacaaagccatcataagggtgaaccaagatccgctcggcattcag
ggaaggctggtgaagacggtcaacaagatagagatctggaaacggcccatcatgccccgg
gtgggtcacgagctgacgcaagcgatcgcgttcgtttcacgccgggccgacggtgcaccg
tacccgctgcgcgtgaagctgcaggaagacgtcggccttagcaacagcaccaacatcaag
ggctacaaagtttacgatctgttcgatgcaaaggcggttccattgctggtgcgcgccggc
agcacgttcgagacaagaatcaacccgaccggggccaatctgtaccgctttgtgccgcag
tttgggacgaattttatcagcttctaa

DBGET integrated database retrieval system