KEGG   Anopheles gambiae (mosquito): AgaP_AGAP005898Help
Entry
AgaP_AGAP005898   CDS       T01036                                 

Definition
AGAP005898-PA
Orthology
K04468  
nemo like kinase [EC:2.7.11.24]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
FoxO signaling pathway
Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:aga00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    AgaP_AGAP005898
   04068 FoxO signaling pathway
    AgaP_AGAP005898
Enzymes [BR:aga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     AgaP_AGAP005898
Protein kinases [BR:aga01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   AgaP_AGAP005898
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2L
AA seq 442 aa AA seqDB search
MAAVGGPARQSRGVSMSVSMSLVQGGAAGAPQGAILAAAAPYFQPPAVPQDVQPDRPIGY
GAFGVVWAVTDPRDGRRVALKKLPNVFQSLVSSKRVFRELKMLCFFKHENVLSALDILQP
PHLDFFQEIYVITELLQSDLHKIIVSPQHLSADHIKVFLYQILRGLKYLHSARILHRDIK
PGNLLVNSNCVLKICDFGLARVEEPDQSKHMTQEVVTQYYRAPEILMGARHYSAAVDVWS
VGCIFGELLGRRILFQAQSPVQQLELITELLGTPSLEDMRHACEGARSHMLRRAPKPRSL
TALYTLSTHATHEAVHLLCQMLVFDPDKRISVIDALAHPYVDEGRLRYHSCMCKCCYTTS
AGMRQYTGEFEPSATQAFDDLWERKLTSVQQVKEEMHKFIAEQLQTGRVPLCINPQSAAF
KSFASSTVAHPSELPPSPHQWE
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atggcggctgtcggtggccctgccaggcaatcacggggggtctccatgagtgtctcgatg
tcgctggtacaaggaggagctgccggtgcgccgcagggcgccatcctggccgcggccgca
ccctacttccagccgccggccgtcccgcaggatgtccagccggaccggccaatcggttac
ggcgcgttcggtgtcgtatgggctgtcaccgatccgcgtgatggacgccgggtcgcactc
aagaagctgcccaacgttttccagtcgctcgtgtcctcgaagcgtgtgttccgcgagctg
aagatgctgtgcttcttcaagcacgaaaatgtactctctgcattggatatcctacagccg
ccacatttggatttcttccaggaaatctacgtgattacggagctgctccagtcggatctg
cacaaaatcatcgtctcgccgcagcacctgtccgctgaccacatcaaagtgttcctgtac
caaatcctgcgcgggctgaagtatctccactcggcgcgcatcctgcaccgggacatcaag
cccggcaacctgctggtgaacagtaactgtgtgctgaagatttgtgattttgggctggcg
cgcgtcgaggaaccggaccaatcgaagcacatgacgcaggaagtcgtcacgcagtactac
cgcgcgccggagatactgatgggcgcccgccactactcggccgccgtcgacgtctggtcg
gtcgggtgcattttcggcgagctgctcggccggcgcattctcttccaggcgcaaagcccc
gtacagcagcttgaactgatcaccgaactgctcggtacgccatcgctggaggatatgcgg
catgcctgcgagggcgccagaagccacatgctgcggagggcaccgaagccccggtcactg
accgcactctacacgctgagcacccatgccacacacgaagccgtacatctgctctgccaa
atgctcgtcttcgatccggacaaaagaatatccgtgatcgatgcgttggcccatccgtac
gtcgacgagggtcgacttcgttaccattcctgcatgtgtaagtgctgttacaccacgtcc
gccggcatgcgccagtacaccggcgagttcgagccatccgccacccaagcattcgacgac
ctgtgggaacgcaaactgacctccgtgcagcaggtgaaagaggaaatgcacaaattcatt
gccgagcagctacagacgggccgcgtgccactgtgtataaatccccaaagcgctgcattc
aaatccttcgctagctcaaccgtagcccatccatcagaactgccaccatcgccgcaccag
tgggaatga

DBGET integrated database retrieval system