KEGG   Anopheles gambiae (mosquito): AgaP_AGAP006441Help
Entry
AgaP_AGAP006441   CDS       T01036                                 

Definition
AGAP006441-PB
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aga00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AgaP_AGAP006441
Enzymes [BR:aga01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     AgaP_AGAP006441
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2L
AA seq 285 aa AA seqDB search
MKEVQVNGHQHVSNGNGTVSELEKHTNGTSNGYAGHNGLSNGTNGTTSNGCASSKKQSVK
CTCSKSELENGSDTNNNQGHEKCTFHHDLELDHKPSTREDLLPLMSKSYRMLLSSLGEDP
ERQGLLKTPERAAKAMLFFTKGYDQSLEEALNGAVFDEDHDEMVVVKDIEMFSMCEHHLV
PFYGKVSIGYLPCKKILGLSKLARIVEIFSRRLQVQERLTKQIAVAVTQAVQPAGVAVII
EGVHMCMVMRGVQKINSKTVTSTMLGVFRDDPKTREEFLTLCNNK
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaagttcaggttaacggtcatcagcatgtgagcaatggcaacggcacggtgagc
gagctggaaaagcacaccaacggcaccagcaacgggtacgccgggcacaacgggctcagc
aatggtacgaacggtaccacctccaatgggtgcgcttcctccaagaaacagtcggtcaaa
tgcacctgcagcaagtcggagctggagaatggtagcgacacaaacaacaatcaaggacac
gaaaaatgtacctttcaccacgatctggaactcgaccacaaaccgtcgacccgggaggac
ctgctgccgctgatgtccaagtcctaccggatgctgctgtcgagcctgggcgaagatccg
gaacgtcagggcctgctgaagactccggaacgggccgccaaggcaatgctcttctttacc
aagggctacgatcagagcttggaagaggccttgaacggtgccgttttcgacgaggatcac
gacgaaatggtcgtggtgaaggacatcgaaatgttctccatgtgcgagcaccacctggtg
ccgttctacggtaaagtctcgatcggttacttgccctgcaagaagattctcgggctgagc
aagctggccagaattgtggagatcttctcacgccgtcttcaggtgcaggagcggctgacg
aaacagattgccgttgccgtcacccaggcagtacagccagccggcgttgccgtcatcatc
gagggagtgcacatgtgcatggtgatgcgcggcgtgcaaaagatcaacagcaaaacggtc
acctcgaccatgctgggcgtcttccgggacgatccgaaaacgcgcgaagagttcctgacg
ctctgcaacaacaagtga

DBGET integrated database retrieval system