KEGG   Anopheles gambiae (mosquito): AgaP_AGAP006511Help
Entry
AgaP_AGAP006511   CDS       T01036                                 

Definition
AGAP006511-PA
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:aga00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    AgaP_AGAP006511
Enzymes [BR:aga01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     AgaP_AGAP006511
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2L
AA seq 470 aa AA seqDB search
MQSHSKKRVCYYYDSDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAD
EMTKFHSDDYIRFLRSIRPDNMSEYNKHMQRFNVGEDCPVFDGLYEFCQLSAGGSVAAAV
KLNKQASEICINWGGGLHHAKKSEASGFCYVNDIVLGILELLKYHQRVLYIDIDVHHGDG
VEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGRGKYYAVNIPLRDGMDDESYDSIFV
PIISKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVKGHGKCVEFVKKYNLPFLMVGGGG
YTIRNVSRCWTYETSVALGVEIANELPYNDYFEYFGPDFKLHISPSNMSNQNTTEYLEKI
KNRLFENLRMLPHAPGVQVQPIPEDAINDESEDEDKVDKDERLPQQDKDKRIVPDNEFSD
SEDEGEGGRRDNRSFKGGQGAGQQQSRKRPRIEKDGKAEEVKDEKEAKSK
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgcagtcacacagcaagaaacgcgtctgctactactacgacagtgatattggcaattac
tactatggccagggacatccgatgaagccgcaccgcatacgtatgacgcacaacctgctg
ctcaactatggcctgtaccggaagatggaaatttatcgtccacacaaggcgacggcggac
gagatgacaaagttccactcggacgattacatccggttcctacgctcgatccgtccggac
aacatgtccgagtacaacaaacacatgcagcgattcaacgtcggtgaggattgtcccgtg
tttgatgggctgtacgagttctgccagctgtcggcgggcggatcggtcgcggctgcggtc
aagctcaacaagcaggcgtcggaaatctgcatcaactggggcggcggtttgcatcacgcg
aaaaagtcggaagcgtccgggttctgctacgtgaacgacatcgtgctcggcatactggag
ctgctcaagtaccaccagcgcgtgctgtacatcgacatcgacgtgcaccatggggacggg
gtggaggaagcgttctacacgaccgatcgcgtcatgacggtcagcttccacaagtacggc
gagtacttccccggcacgggcgacctgcgcgacattggggccggccggggcaagtactac
gcggtcaacattccgctgcgggacggcatggacgacgagtcgtacgattcgatcttcgtg
ccgatcatctcgaaggtgatggaaacgttccagccgtcggcggtggtgctgcagtgcggg
gcggactcgctgaccggcgatcggctcggctgcttcaacctgacggtcaaggggcacggc
aagtgcgtggagtttgtgaagaagtacaacctgccgttcctgatggtgggcggcggcggc
tacacgatccgcaacgtgtcccgctgctggacgtacgaaacgtcggtcgcgctcggggtg
gagatcgcgaacgagctgccgtacaacgactacttcgagtacttcgggcccgactttaag
ctgcacatcagcccgagcaacatgtcgaaccagaacacgaccgagtatctggagaagatc
aagaaccggctgttcgagaatttgcgcatgctgccgcacgcgccgggcgtacaggtgcag
ccgatcccggaggacgcgatcaacgacgagtcggaggacgaggataaggtggacaaggac
gagcggctgccgcagcaggacaaggacaagcggatagtgccggacaacgagttttctgat
tcggaggacgagggcgaagggggccgaagggataaccgctcgttcaagggtgggcagggg
gcagggcagcagcagtcccgcaagcggccccgcatcgagaaggacggcaaggcggaggag
gtgaaggacgagaaggaggcgaaaagtaagtaa

DBGET integrated database retrieval system