KEGG   Anopheles gambiae (mosquito): AgaP_AGAP006569Help
Entry
AgaP_AGAP006569   CDS       T01036                                 

Definition
AGAP006569-PA
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aga00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AgaP_AGAP006569
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AgaP_AGAP006569
   00620 Pyruvate metabolism
    AgaP_AGAP006569
   00640 Propanoate metabolism
    AgaP_AGAP006569
Enzymes [BR:aga01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     AgaP_AGAP006569
Lipid biosynthesis proteins [BR:aga01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   AgaP_AGAP006569
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2L
AA seq 669 aa AA seqDB search
MPSEPEKIFNPHPDVASKAYINSMQQYREFYQQSLENPGQFWANVAKQFHWETPYDPKNF
FSYNFDISKGPIYVKWMEGASTNICYNLLDRNVKNGLGDTVAYYWEGNHPDDYSRLTYRK
LLEEVCRFANVLKSHGVQKGDRVSIYMPMTMELPVAMLACARIGAVHSIVFAGFSSDSLA
ERMHDCQAKVLITADGAWRGEKILHLKDICDTAMDKAEELGHHVQTCIVVSHINRVTPGK
EDWDGSFDTPWRDGRDFWWHQEMEDAEPACYPEWMSAEDPLFMLYTSGSTGKPKGVLHTT
AGYLLYAATTFKIVFDYKPNDIYWCTADIGWITGHTYVLYGPLANGATSVMFEGTPFFPD
TDRYWEIIDKYKVSQFYTAPTAIRSLMKFGDEPVLKHDLSSLRVLGSVGEPINPEAWLWY
YRVIGKERCSIVDTFWQTETGGHVITPLPGATPMKPGSASFPFFGVKPTLLDESGTEITG
EGEGYLVFSQPWPGMMRTLFNNHPRYESTYFSKFNGYYCTGDGARRDADGYFWVTGRVDD
MLNVSGHLMSTSEVESVLTEHPRVSEAAVVSRPHPVKGECLYCFITPNQNEAFDKTLISE
LKVLVRERIGPFAQPDVIQHAPGLPKTRSGKIMRRVLRKVAVNDRDVGDTSTLADEAIIE
QLFANRPAH
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgccgtcggaaccggagaagattttcaacccccatccggatgtcgccagcaaggcgtac
atcaacagtatgcagcagtaccgcgagttttaccagcagtcgctggagaatccgggccag
ttctgggccaatgtggccaagcagttccactgggagacgccgtacgatccgaagaacttc
ttctcgtacaacttcgacatctcgaaaggtcccatctacgtaaagtggatggagggtgcc
tcgaccaacatttgctacaacttgctggatcgcaacgtgaagaacgggctcggcgatacc
gtcgcttactactgggaaggcaatcatcccgatgactacagccggctaacgtacaggaag
ctgctcgaggaggtatgccggttcgcgaacgtgctaaagagccacggcgtccagaagggt
gaccgggtgtcgatctacatgcccatgaccatggagctgccggttgcaatgctggcctgt
gcacgcatcggtgccgttcactcgattgtgtttgccggtttctcgtccgattcgctcgcc
gagcgcatgcacgactgccaggcgaaggtgctgatcacggccgacggtgcctggcggggc
gagaagatcctgcacctgaaggacatctgtgataccgcgatggacaaggcggaagagctc
ggccaccacgtgcagacgtgcattgtcgtgtcgcacattaaccgggtcacgccgggcaag
gaggactgggacggttcgttcgataccccatggagagatggacgcgacttttggtggcac
caggagatggaggacgccgaaccggcctgctacccggagtggatgtcggccgaggaccca
ctgtttatgctgtacactagcggctcgaccggcaaaccgaagggtgtgctgcatacgacc
gccggctacctgctgtacgcggccacgaccttcaagatcgtgttcgactacaagccgaac
gatatctactggtgcacggccgacatcggttggattacgggccacacgtacgtgctgtac
ggtccgctcgctaacggtgccacctcggtcatgttcgagggcacaccgttcttcccggac
acggaccggtactgggagatcatcgacaagtacaaggtgtcgcagttttataccgcaccg
accgcgatccggtcgctgatgaagtttggcgacgagccggtgctgaagcatgatctatcg
agtcttagagttctcggtagtgtcggtgagccgatcaatccggaagcgtggctttggtac
tatcgggtgatcggcaaggagcgctgttcgatcgtggacaccttctggcagacggagaca
ggcggacacgtgattacacccctgccgggcgctacaccaatgaagcctggctctgcatca
ttcccgttctttggcgtgaaaccgacgctgctggacgaaagcggtacggaaattacgggc
gaaggtgaaggctatctcgtcttttcccagccctggccgggtatgatgcgcacgctgttc
aacaaccatccgcgctacgaatcgacgtacttttccaagttcaatggatactactgtacg
ggtgatggcgcacgtcgcgatgcggacggctacttctgggtgacggggcgcgtcgacgac
atgctgaacgtgtcgggccatctgatgtccacgtcggaggtcgagtcggtgctgaccgag
catccgcgcgtctcggaagcggccgtcgtatcccgacctcacccggtcaagggcgaatgt
ttgtactgcttcatcacgcccaaccagaacgaagcgttcgacaaaacgctcatcagcgag
ctgaaggtgctggtgcgggagcgcatcggtccgttcgcgcagccggacgtgatccagcat
gcgcccgggctgccgaaaacgcgctcgggcaagattatgcgacgagtgctgcgcaaggtg
gccgtcaacgatcgggatgtgggcgatacgtccacactggcggacgaggccatcatcgag
cagctgtttgctaaccggccggcccactaa

DBGET integrated database retrieval system