KEGG   Anopheles gambiae (mosquito): AgaP_AGAP006613Help
Entry
AgaP_AGAP006613   CDS       T01036                                 

Gene name
EIF3J_ANOGA
Definition
AGAP006613-PB
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
aga  Anopheles gambiae (mosquito)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:aga00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    AgaP_AGAP006613 (EIF3J_ANOGA)
Translation factors [BR:aga03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    AgaP_AGAP006613 (EIF3J_ANOGA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2L
AA seq 152 aa AA seqDB search
MTPEQQLAEKRRLQKLQEENDLKTAMETLGITPMSTGNGIDGMHPTTKEEFTELAEAISK
KLANYRASTEYQGFLEELLLKLFASLSSNNIRKAKTTLDNLYLEKQKVEKGDKPKKTKGI
KVKAKLRVEGENTTLNEYETKYDDYDDYDDFM
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgacgccggaacagcaactggccgaaaagcgaaggctgcagaagctgcaggaagaaaat
gacctgaaaacggccatggaaacgctaggcatcacgccaatgtccacgggcaacggtatc
gatggaatgcatccgaccacgaaggaggagtttaccgaactggccgaagcgattagcaaa
aagctggccaactaccgtgcgagtacggaatatcaaggctttttggaagagctgttgctg
aaactgtttgccagcctgtcgtccaataacattcggaaagctaaaaccaccctagacaac
ttgtacttggaaaagcagaaggtcgagaaaggtgacaagccaaagaagaccaaaggcatc
aaggtgaaagcgaagctgcgtgtcgagggtgaaaatactactttgaacgagtatgaaacc
aagtatgatgattacgacgattacgatgattttatgtaa

DBGET integrated database retrieval system