KEGG   Anopheles gambiae (mosquito): AgaP_AGAP006778Help
Entry
AgaP_AGAP006778   CDS       T01036                                 

Definition
AGAP006778-PA
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aga00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    AgaP_AGAP006778
Enzymes [BR:aga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     AgaP_AGAP006778
Exosome [BR:aga04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AgaP_AGAP006778
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2L
AA seq 519 aa AA seqDB search
MSTTGGMKKFGDLVGSIDEGTSSARFLLFRAETAEVVCFHQKELRLICPQEGWVEQDPHE
ILSVVYECIERTLEKLVELGGNPQTDIVAIGVTNQRETTIVWDRTTGEPLYNAIVWQDMR
TSSTVDQLLETVPNKTKNKNYLKPLCGLPLSPYFSAVKLRWLLDNVPKVKGAVRAGSCLF
GTVDTWLIWNLTGGPDGGAHVTDVSNASRTMLMNIETLKYDKALMKFFDVPLEILPTIRS
SSEVYGLIKFRPLQHIPLAGCLGDQQSALVGQECLTRGRAKATYGTGCFLLYNTGTAVID
SYHGLISTVAYQMGPDALPVYALEGSVAVAGAALGWLRDNLNLIGGASESESAALEVENN
GDVYFVPAFSGLYAPYWDPEARGVICGITEDTQRGHIVRAALEAVCFQVRDILDAMNNDS
GTPLQKLKVDGGMTANATMMQWQADLIGLDVLKPKFVETTALGAAMVAGRAVGKWDIENV
SVESDSTVFKPQISENERDVRYKRWKMAIERAVGWDKCL
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccaccggcgggatgaagaaattcggcgacctcgtcggctcgatcgacgagggc
accagctcggcccggtttctgctgttccgggcggagacggccgaggtggtgtgcttccac
cagaaggagctgcgcctgatctgcccccaggagggttgggtcgagcaggatccgcatgaa
atcctgagcgtcgtgtacgagtgcatcgagcgcacgctggagaagctggtcgagctgggc
ggcaatccgcagaccgacatcgtggcgatcggtgtgacgaaccagcgcgagacgacgatc
gtgtgggaccgcacgaccggcgaaccgctgtacaatgcgatcgtttggcaggacatgcgc
acgtcctcgacggtggaccagctgctcgagacggtaccgaacaagacgaagaacaaaaac
tacctcaaaccgctgtgcgggctgccgctgtcgccgtacttctccgccgtcaagctgcgc
tggctgctcgacaacgtgccgaaggtgaagggggcggtccgcgccggcagctgcctgttc
ggcacggtcgacacgtggctgatctggaacctgaccggcggtccggacgggggcgcccac
gtcacggacgtgtcgaacgcgtcccgcaccatgctgatgaacatcgagacgctcaagtac
gacaaggcgctgatgaagttcttcgacgtgccgctggaaatactgcccaccatccggtcc
agctcggaggtgtacgggctgatcaagtttcggccgctgcagcacatcccgctggccggc
tgcctgggtgaccagcagtcggcactggtcgggcaggagtgtttgacgcgcggacgggca
aaggcaacgtacgggacgggatgctttctgctgtacaacaccgggacggcggtgatcgac
tcgtaccacgggctgatctcgaccgtcgcctaccagatgggaccggacgcgctgcccgtg
tacgcgctggagggttcggtggcggtggccggtgccgccctcggctggttgcgcgacaac
ctgaacctgatcgggggtgcctccgagtcggaatcggccgcactggaggtggagaacaat
ggggacgtgtactttgtgccggcgttcagtgggctgtacgcaccgtactgggatccggag
gcgcgcggcgtcatctgcggcatcacggaggacacgcagcgggggcacatcgtgcgggcg
gcgctggaggcggtctgctttcaggtgcgcgacatactggacgcaatgaacaacgacagc
ggcacgccgctgcagaagctcaaggtggacggtggcatgacggcgaacgcgaccatgatg
cagtggcaggcggacctgatcgggctggacgtgttgaagcccaagtttgtcgagacgacg
gcactgggtgctgccatggtagcgggccgtgcggttggcaagtgggatatcgagaacgtg
agcgtggaaagcgacagtaccgtgtttaagccacaaatcagcgaaaacgagcgggacgtc
cggtacaagcggtggaagatggccatcgaacgggctgtcggttgggacaagtgtctgtaa

DBGET integrated database retrieval system